KEGG   Desulfurococcus mucosus: Desmu_1055Help
Entry
Desmu_1055        CDS       T01406                                 

Definition
succinyl-CoA synthetase subunit beta
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
dmu  Desulfurococcus mucosus
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:dmu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Desmu_1055
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Desmu_1055
   00640 Propanoate metabolism
    Desmu_1055
   00660 C5-Branched dibasic acid metabolism
    Desmu_1055
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Desmu_1055
Enzymes [BR:dmu01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Desmu_1055
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1036869..1038008)
Genome map
AA seq 379 aa AA seqDB search
MKLYEYEGKEIARRYGVDVPRGLLASSVEEVAEAYRRLGSQVVVLKAQVLVGGRGLAGGV
KKAGSLEEAVAKAGELFSTSIRGERVGKLLVEEAVCISRELYVSLTVDRASRRLVYLVSG
MGGVEIEELARRHPDKVLRIPVDPFNGFSSYMARQALGFLGLPWDKLGVLENVMRAMYRI
MVDYDAELVEFNPLAYTCSGGLTALDAKVIVDDNSLYRHPDLQPLYGRDASSYERLAKQL
EFNYVELDGDIGVISNGAGLTMATMDAILHYGGRPANFLDIGGGATRERVREAAKIVLTH
PRVKAVLVNIFGGITRCDEVAAGVVEALKEAGVAKPVVVRMLGTNEEEGRRILREHGINA
YTEMDEAVLKVVQLAREVG
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgaagctctacgagtatgagggtaaggagatagctaggaggtatggtgtcgacgtcccc
agggggctccttgcctcgagtgttgaggaggttgcggaggcgtataggaggcttggctcc
caagtggtggttttaaaggcgcaggtgcttgtaggcggtaggggtttagccggcggcgtg
aagaaggctgggagccttgaggaagcggtggctaaggccggcgagctgttctccacgagt
ataaggggtgagagggttgggaaactccttgtcgaggaggctgtctgcatctcccgcgag
ctctacgtctccctcaccgttgacagggcgtcgaggaggctggtctaccttgtctcaggg
atgggcggggtggagatagaggagcttgcgaggaggcacccggataaggtacttaggatc
cctgtagaccccttcaacgggttcagcagctacatggctaggcaggcgctgggcttcctc
gggcttccatgggataaactaggggttctcgagaacgttatgagagccatgtacaggatt
atggttgactacgatgccgagctcgttgagttcaacccgcttgcatacacgtgtagcggg
gggcttacagccctggatgccaaggtgatcgtggacgataacagcttgtacaggcacccg
gatctacagcccctctacgggagggatgcatccagctatgagcggcttgccaagcagttg
gagttcaactacgtggagctggacggcgatataggggtgataagtaatggagccgggttg
accatggccacgatggacgccatcctccactacggtgggaggccggctaacttcctggat
atagggggtggggcaacccgtgaaagggttagggaggctgctaaaatagtgctcactcat
ccaagggttaaagcagtcctcgtcaacatatttggaggtataacgagatgcgatgaggtt
gcagcaggagtcgttgaagccttgaaggaggccggggtggctaagccagtcgtggtcagg
atgcttggcaccaatgaggaggaggggaggaggatactcagggagcacgggataaacgct
tacacggagatggatgaagcggttttaaaagtggttcaactagcgagggaggtgggttag

DBGET integrated database retrieval system