KEGG   Desulfurococcus mucosus: Desmu_1135Help
Entry
Desmu_1135        CDS       T01406                                 

Definition
zinc-binding alcohol dehydrogenase family protein
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
dmu  Desulfurococcus mucosus
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:dmu00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Desmu_1135
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Desmu_1135
  Lipid metabolism
   00071 Fatty acid degradation
    Desmu_1135
  Amino acid metabolism
   00350 Tyrosine metabolism
    Desmu_1135
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Desmu_1135
   00626 Naphthalene degradation
    Desmu_1135
Enzymes [BR:dmu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Desmu_1135
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1099645..1100649)
Genome map
AA seq 334 aa AA seqDB search
MKAMVLYSPSPIESKPLRYMDVDKPSPGRGEVLIRVHKCGVCRTDLHIVEGELKPVKLPV
IPGHQVVGVVEEVGEGVEGVSPGERVGVPWLYYSCGECRYCRRGLENLCENALFTGYSVD
GGYAEYMVAKAGFIHRIPGSIGDEHAAPLMCAGAVGYRSLKLTGLLGRSDAVLGLFGYGA
AAHLVLQVARRLGLRVYVFTSSRWKIEKALENGAEWAGGTSEEPPRKLDAAIVYAPVSQV
FIEALRKVDKGGRVVLAEIYMTPVERLDYSLLWYEREVKSVANVTRRDVREFLEIAEKHG
VKPEVKTYGLKEANEALEELKKGGHLGQIVLDIA
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
ttgaaggcgatggttctatactccccgtcccccattgagtcgaagccgcttagatacatg
gatgtagacaagccgagccctggcaggggcgaggtattgataagggttcacaagtgcggt
gtatgcaggacagacctccatattgttgaaggcgagttaaagcccgtgaagctcccagtg
ataccgggccaccaggttgtgggcgtggtggaggaggttggcgagggtgttgaaggggtc
tccccaggggagagggttggggtcccatggctatactactcctgcggtgaatgcaggtat
tgtaggagagggcttgaaaacctctgtgagaacgccttgttcacagggtatagtgttgac
gggggttacgctgagtacatggtggctaaggccggcttcatacacaggatccctggtagt
ataggtgacgagcatgccgcgccattaatgtgtgccggggcagtgggctaccggtcgctt
aagctcaccgggctcctcggtcgaagcgatgcagtgctcggcttattcggctatggggcg
gctgcacacctagtgctccaggtggctaggaggctcgggttaagggtctacgtgttcaca
agcagcaggtggaagatagagaaggcgcttgagaacggggctgaatgggctggtggaaca
agcgaggagccaccgcgtaagcttgacgcagcgatagtctacgcgccggtttcacaggtc
ttcatcgaggcgttaaggaaggttgataagggcggtagagttgtgttagccgagatatac
atgacgccggtggagagactcgactacagcctcctatggtatgagagggaggttaagagc
gttgccaacgtgacgaggagggatgtacgcgagttcctggagatcgctgagaaacacggt
gtgaaaccggaggttaagacatatgggttgaaagaagccaacgaggcccttgaggagttg
aagaagggaggccacctcggccagatagtcctggatattgcttga

DBGET integrated database retrieval system