KEGG   Desulfurococcus mucosus: Desmu_1189Help
Entry
Desmu_1189        CDS       T01406                                 

Definition
pyruvate/ketoisovalerate oxidoreductase subunit gamma
Orthology
K00172  
pyruvate ferredoxin oxidoreductase, gamma subunit [EC:1.2.7.1]
Organism
dmu  Desulfurococcus mucosus
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:dmu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Desmu_1189
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Desmu_1189
   00020 Citrate cycle (TCA cycle)
    Desmu_1189
   00620 Pyruvate metabolism
    Desmu_1189
   00640 Propanoate metabolism
    Desmu_1189
   00650 Butanoate metabolism
    Desmu_1189
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Desmu_1189
   00680 Methane metabolism
    Desmu_1189
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Desmu_1189
Enzymes [BR:dmu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Desmu_1189
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1142663..1143241
Genome map
AA seq 192 aa AA seqDB search
MLYEILFFGRGGQGAVTAANILVEAAMMEGKHGQGFPFFGAERRGAPVTAFARISDKPIL
RHGMFSEADIIVVLDPGLLDLGVVKRGVLRENGVVVVNTEKDHIPPGSLNHRGRARIYRV
DATRIARELGLVIAGWPVVNTSMLGALAKATGLIGVESVEKAIGDYFGGKAGELNKLAAE
RAYGETKLVLEV
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgctatatgaaatactgttcttcgggagaggcgggcagggcgctgtaacagccgccaac
atactcgtggaggctgcaatgatggagggaaagcatggtcaaggcttccccttcttcggc
gcggagaggaggggagcccctgtgacagcgttcgcacggatcagcgataaacccatcctg
aggcacggcatgttcagcgaggccgacatcatagttgtgctagacccaggactactggat
ctaggcgtggttaagagaggagtgctcagggagaatggtgtagtagtggttaacactgag
aaagaccacatacctcccggtagcctgaaccaccgtggcagggcaaggatctacagggta
gatgccacaaggatagcgagggagctggggctggttatagctggatggcccgttgtgaac
acaagcatgctgggggcccttgccaaggcaaccgggctcataggtgttgaaagcgttgag
aaggccatcggggattacttcggggggaaagcaggcgaattaaacaagctggctgctgaa
cgtgcttacggggagacaaagctggttctcgaggtgtaa

DBGET integrated database retrieval system