KEGG   Desulfurococcus mucosus: Desmu_1238Help
Entry
Desmu_1238        CDS       T01406                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
dmu  Desulfurococcus mucosus
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:dmu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Desmu_1238
   01230 Biosynthesis of amino acids
    Desmu_1238
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Desmu_1238
   00051 Fructose and mannose metabolism
    Desmu_1238
   00562 Inositol phosphate metabolism
    Desmu_1238
Enzymes [BR:dmu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Desmu_1238
Exosome [BR:dmu04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Desmu_1238
  Exosomal proteins of bladder cancer cells
   Desmu_1238
  Exosomal proteins of melanoma cells
   Desmu_1238
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1187189..1187881)
Genome map
AA seq 230 aa AA seqDB search
MVKPILAVNFKAYYPHSFGGNAYRIALDAVRVWRETGVEVILAPPFTELRRILEAVSGTE
VKVYAQHADPVEPGAVTGFIPLEGLKDAGIHGVILNHSEHKLRVSEVNYLVKKAKSLGLK
TLVCADTPETGAAVAVLEPDMVAVEPPELIGTGVSVSRAKPEVVTNSVNMIRRVNEKVTV
LTGAGISNGEDAYMAVKLGTMGVLVASGIVKAKDPYQVMKDMAEGMLKAL
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atggttaagccaatactagcagtgaactttaaagcatactacccgcatagcttcggtgga
aacgcctataggatagccctcgacgctgtcagagtctggagggagacaggggtagaagta
atactggccccgcccttcacagagctgaggaggatccttgaagccgtgagtggaaccgag
gtcaaggtatacgcgcagcacgcggaccccgttgaacccggggccgtcacaggcttcatc
cctcttgaagggttaaaggacgcagggatccatggcgtgatactcaaccacagtgagcac
aagctcagggtctcagaggtaaactacctggttaagaaggctaagagcctcgggttgaag
acacttgtatgcgccgacacacctgagacaggtgcagccgtagccgtgttggagcccgac
atggttgccgtggagccacccgagctaataggtacgggtgtaagcgttagcagggctaaa
ccggaggtagtgacgaatagtgtgaacatgattaggagggttaacgagaaggtgaccgtg
ttgactggtgcaggtatctccaacggtgaagacgcatacatggcggttaagcttggaaca
atgggtgtcctagtggcatccggaatagttaaggcgaaagacccctatcaagtcatgaag
gatatggctgagggcatgttgaaggccctatag

DBGET integrated database retrieval system