KEGG   Desulfurococcus mucosus: Desmu_1238Help
Entry
Desmu_1238        CDS       T01406                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
dmu  Desulfurococcus mucosus
Pathway
dmu00010  Glycolysis / Gluconeogenesis
dmu00051  Fructose and mannose metabolism
dmu00562  Inositol phosphate metabolism
dmu01100  Metabolic pathways
dmu01110  Biosynthesis of secondary metabolites
dmu01120  Microbial metabolism in diverse environments
dmu01130  Biosynthesis of antibiotics
dmu01200  Carbon metabolism
dmu01230  Biosynthesis of amino acids
Module
dmu_M00002  Glycolysis, core module involving three-carbon compounds
dmu_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:dmu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Desmu_1238
   00051 Fructose and mannose metabolism
    Desmu_1238
   00562 Inositol phosphate metabolism
    Desmu_1238
Enzymes [BR:dmu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Desmu_1238
Exosome [BR:dmu04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Desmu_1238
  Exosomal proteins of bladder cancer cells
   Desmu_1238
  Exosomal proteins of melanoma cells
   Desmu_1238
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM ThiG IGPS FMN_dh DHO_dh His_biosynth B12-binding CutC
Motif
Other DBs
NCBI-ProteinID: ADV65534
UniProt: E8R769
Position
complement(1187189..1187881)
Genome map
AA seq 230 aa AA seqDB search
MVKPILAVNFKAYYPHSFGGNAYRIALDAVRVWRETGVEVILAPPFTELRRILEAVSGTE
VKVYAQHADPVEPGAVTGFIPLEGLKDAGIHGVILNHSEHKLRVSEVNYLVKKAKSLGLK
TLVCADTPETGAAVAVLEPDMVAVEPPELIGTGVSVSRAKPEVVTNSVNMIRRVNEKVTV
LTGAGISNGEDAYMAVKLGTMGVLVASGIVKAKDPYQVMKDMAEGMLKAL
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atggttaagccaatactagcagtgaactttaaagcatactacccgcatagcttcggtgga
aacgcctataggatagccctcgacgctgtcagagtctggagggagacaggggtagaagta
atactggccccgcccttcacagagctgaggaggatccttgaagccgtgagtggaaccgag
gtcaaggtatacgcgcagcacgcggaccccgttgaacccggggccgtcacaggcttcatc
cctcttgaagggttaaaggacgcagggatccatggcgtgatactcaaccacagtgagcac
aagctcagggtctcagaggtaaactacctggttaagaaggctaagagcctcgggttgaag
acacttgtatgcgccgacacacctgagacaggtgcagccgtagccgtgttggagcccgac
atggttgccgtggagccacccgagctaataggtacgggtgtaagcgttagcagggctaaa
ccggaggtagtgacgaatagtgtgaacatgattaggagggttaacgagaaggtgaccgtg
ttgactggtgcaggtatctccaacggtgaagacgcatacatggcggttaagcttggaaca
atgggtgtcctagtggcatccggaatagttaaggcgaaagacccctatcaagtcatgaag
gatatggctgagggcatgttgaaggccctatag

DBGET integrated database retrieval system