KEGG   Desulfurococcus mucosus: Desmu_1239Help
Entry
Desmu_1239        CDS       T01406                                 

Definition
(RefSeq) fructose-bisphosphate aldolase
  KO
K01622  
fructose 1,6-bisphosphate aldolase/phosphatase [EC:4.1.2.13 3.1.3.11]
Organism
dmu  Desulfurococcus mucosus
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:dmu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Desmu_1239
   01230 Biosynthesis of amino acids
    Desmu_1239
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Desmu_1239
   00030 Pentose phosphate pathway
    Desmu_1239
   00051 Fructose and mannose metabolism
    Desmu_1239
  Energy metabolism
   00680 Methane metabolism
    Desmu_1239
Enzymes [BR:dmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     Desmu_1239
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     Desmu_1239
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1187919..1189067)
Genome map
AA seq 382 aa AA seqDB search
MCAKVTLSVIKADLGSIAGHHMPHPDQLAVATKILAEAKQKGLIIDFYVTHVGDDIQLII
THNKGPDHPDIHGLAWDAFKAATKVARELKLYAAGQDLLSEAFSGNVKGLGPGVAELEME
EREAEPVVTFHADKTEPGAFNLPLFRIFADPFNTAGLVIDPKMHDGFVFEVYDVFEGRSV
LLKSPEEMYDILALIGTPGRYIVRRVYRKSDNLLAAVVSVERLNLIAGKYVGKDDPVAIV
RAQHGLPAVGEILEAFSFPHLVAGWMRGSHNGPLMPVPMRYARVTRFDGPPRVIALGWNI
SNGRLIGPADLFDDVAFDETRRLAQNIAEYMRRHGPFMPHRLGPEEMEYTTLPAVLEKLK
DRFVKSEEVKVVKKHSDMLSGS
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgtgtgcgaaggtaacactctcagttattaaagcagacctaggcagtattgcaggccac
cacatgccccaccccgatcaactagccgttgcaacaaaaatactggctgaagccaagcag
aagggtttgataatagacttctacgtaacccacgtaggcgacgacatccagttaataatc
acccacaacaagggacccgaccacccagacatccatgggttagcatgggacgccttcaaa
gcagccaccaaagtagcccgtgaactcaaactctacgcggccggccaagacctcctctcc
gaagcattctcaggcaacgttaagggcctagggcccggcgtagccgagttggaaatggag
gagagggaggccgagcccgtggtgacgttccacgctgataaaaccgagccaggagccttc
aacctccccttattcaggatattcgcggaccccttcaatacggcgggactagtgatagac
cccaagatgcacgacggcttcgtcttcgaggtatacgatgtcttcgagggccggagcgtg
ctattgaagtcgcctgaagaaatgtacgatatcctcgcgttgataggcacccctgggaga
tacattgtgagaagagtatacaggaagagcgacaacctgctggcagcagttgtaagcgtg
gagagattgaacctcatagcaggcaagtacgttgggaaggatgacccagtagcaatcgtg
agagcacagcacgggctacccgccgtaggcgagatccttgaagcattcagcttcccccac
ctagtggcgggatggatgaggggcagccacaacgggccattaatgcccgtccccatgagg
tatgctagagtaacaaggttcgacggtccgccgagagtcatagcgcttggatggaacatc
tccaacgggaggctaatagggccggcagacctattcgacgacgtggccttcgatgaaaca
aggaggctggcgcagaacatagccgagtacatgaggaggcacggccccttcatgccgcat
agactgggacccgaggaaatggagtacactaccctcccagctgtactggagaagttgaag
gatagattcgtcaaaagcgaggaagtcaaagtggtcaagaagcacagcgacatgttatcc
gggagctga

DBGET integrated database retrieval system