KEGG   Desulfurococcus mucosus: Desmu_1285Help
Entry
Desmu_1285        CDS       T01406                                 

Definition
(GenBank) L-threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
dmu  Desulfurococcus mucosus
Pathway
dmu00260  Glycine, serine and threonine metabolism
dmu00750  Vitamin B6 metabolism
dmu01100  Metabolic pathways
dmu01110  Biosynthesis of secondary metabolites
dmu01120  Microbial metabolism in diverse environments
dmu01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:dmu00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Desmu_1285
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Desmu_1285
Enzymes [BR:dmu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Desmu_1285
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP zinc_ribbon_2 zf-C4_Topoisom Mu-like_Com OrfB_Zn_ribbon
Motif
Other DBs
NCBI-ProteinID: ADV65581
UniProt: E8R7B6
Position
complement(1237046..1238107)
Genome map
AA seq 353 aa AA seqDB search
MHWKCPYCGFEADALKEYYWKCPRCGKPLVLSYTGKLGRQGSRNIWERYGDAVPLKPEKT
RGEGNTPLVSEKMDGVTVLFKLEYLNPGGSFKDRGSSLAVYYAYKTGFRSVVEDTSGNTG
ISVALYSRLYGLNARIYMPRTAPEGKKKAVRMLGAQVVEAPSRGEAAEMVLRETGGGAFY
VAHTWSYLYILGASTIAWEVLEEDTPDYVIAPVGSGGLFLGLVKGFEKALEAGWITKMPR
FIAVQGYSTQPVHKAFKGVEQPGEESTLADGIMVPNPPRLEEIVEALRRYQGDILLVGNT
EVEKAWRELWELGFLVEPTSAAAYAALSRSKNQFTGRKTLVVLTGSGLKTLTG
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgcattggaaatgcccctactgcggcttcgaagcagacgccttgaaagaatactactgg
aagtgcccccggtgcggtaaacccctagtgctctcatacactggtaaactagggagacag
ggctccaggaacatatgggagaggtatggggacgcagtacccttgaagcctgagaagacc
aggggggagggcaacaccccactggtctccgagaaaatggacggggtcacagtgctcttc
aagcttgaataccttaacccgggcgggagcttcaaggaccgcgggtcctccctagccgtc
tactacgcctataaaaccggcttccgcagcgtggtcgaggatacaagcggtaacacaggt
atctccgtcgccctgtactcgaggctctacggtttaaacgcaaggatatacatgcctaga
acagcgcccgaggggaagaagaaggctgtcagaatgctgggcgcccaggttgttgaagca
ccttcacggggggaggctgctgaaatggttctaagggagactggtggaggagccttctac
gtggcgcacacgtggagctacctctacatacttggagcctcaacaatagcatgggaggtc
ctcgaggaggatacaccggactacgttatagccccagtcggctcaggcgggctcttcctc
ggactagtgaaaggcttcgagaaagcccttgaagcgggatggataaccaagatgccgagg
ttcatcgctgtacagggatactcaacgcaaccagtgcacaaggctttcaaaggcgttgaa
caacccggcgaggagtcaacgctcgcagacggcataatggtgccgaaccccccgaggctg
gaggaaatagttgaagcattgagaagataccagggagacatactactcgtcggcaacacc
gaggtggagaaagcttggagagaactgtgggaactaggattcctcgtggagccaacgtca
gcagccgcctacgccgccctctccaggagcaagaaccagttcacgggtaggaaaaccctc
gtagtgttaacgggctcaggcctcaagacgcttacagggtga

DBGET integrated database retrieval system