KEGG   Desulfurococcus mucosus: Desmu_1285Help
Entry
Desmu_1285        CDS       T01406                                 

Definition
L-threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
dmu  Desulfurococcus mucosus
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:dmu01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:dmu00260]
Metabolism; Metabolism of cofactors and vitamins; Vitamin B6 metabolism [PATH:dmu00750]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1237046..1238107)
Genome map
AA seq 353 aa AA seqDB search
MHWKCPYCGFEADALKEYYWKCPRCGKPLVLSYTGKLGRQGSRNIWERYGDAVPLKPEKT
RGEGNTPLVSEKMDGVTVLFKLEYLNPGGSFKDRGSSLAVYYAYKTGFRSVVEDTSGNTG
ISVALYSRLYGLNARIYMPRTAPEGKKKAVRMLGAQVVEAPSRGEAAEMVLRETGGGAFY
VAHTWSYLYILGASTIAWEVLEEDTPDYVIAPVGSGGLFLGLVKGFEKALEAGWITKMPR
FIAVQGYSTQPVHKAFKGVEQPGEESTLADGIMVPNPPRLEEIVEALRRYQGDILLVGNT
EVEKAWRELWELGFLVEPTSAAAYAALSRSKNQFTGRKTLVVLTGSGLKTLTG
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgcattggaaatgcccctactgcggcttcgaagcagacgccttgaaagaatactactgg
aagtgcccccggtgcggtaaacccctagtgctctcatacactggtaaactagggagacag
ggctccaggaacatatgggagaggtatggggacgcagtacccttgaagcctgagaagacc
aggggggagggcaacaccccactggtctccgagaaaatggacggggtcacagtgctcttc
aagcttgaataccttaacccgggcgggagcttcaaggaccgcgggtcctccctagccgtc
tactacgcctataaaaccggcttccgcagcgtggtcgaggatacaagcggtaacacaggt
atctccgtcgccctgtactcgaggctctacggtttaaacgcaaggatatacatgcctaga
acagcgcccgaggggaagaagaaggctgtcagaatgctgggcgcccaggttgttgaagca
ccttcacggggggaggctgctgaaatggttctaagggagactggtggaggagccttctac
gtggcgcacacgtggagctacctctacatacttggagcctcaacaatagcatgggaggtc
ctcgaggaggatacaccggactacgttatagccccagtcggctcaggcgggctcttcctc
ggactagtgaaaggcttcgagaaagcccttgaagcgggatggataaccaagatgccgagg
ttcatcgctgtacagggatactcaacgcaaccagtgcacaaggctttcaaaggcgttgaa
caacccggcgaggagtcaacgctcgcagacggcataatggtgccgaaccccccgaggctg
gaggaaatagttgaagcattgagaagataccagggagacatactactcgtcggcaacacc
gaggtggagaaagcttggagagaactgtgggaactaggattcctcgtggagccaacgtca
gcagccgcctacgccgccctctccaggagcaagaaccagttcacgggtaggaaaaccctc
gtagtgttaacgggctcaggcctcaagacgcttacagggtga

DBGET integrated database retrieval system