KEGG   Dichelobacter nodosus: DNO_0021Help
Entry
DNO_0021          CDS       T00517                                 

Definition
beta-hexosaminidase (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
dno  Dichelobacter nodosus
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:dno00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:dno00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
27263..28267
Genome map
AA seq 334 aa AA seqDB search
MSLFIGIEQTKLCRADKRRLQSPLCSGVVLFSRNYQNPEQLRALIQEIRQLRPQILIGVD
HEGGRVQRFREGFTLLPAAAQIGRIFDQDPVISWSVAQACGVILAYELRAQSIDFSFAPV
LDLYDPKSTVIGDRAFHENPAIVSVLSCSMRRGMKTVGMAAVGKHFPGHGRVSGDSHHEL
PIDTRSDAERRADLVPFIFNVQQDIEALMMAHILMPDDTLPASFSAKIIQELRDWGFKGA
VVSDDLDMAAAKQFATPTQCVQAVLDAGADAAMICNHFADMDRVIDEGVTVRDSAASQKR
LALLRGAEYDDFVAEQAYQKAQATLTKYRSWFVA
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgtctctttttatcggtatcgaacagacgaaattatgccgcgcggataagcggcgtttg
cagtcgcctttatgttctggcgtggttttattcagtcgcaattatcaaaatcccgagcaa
ttacgcgctttaatccaagaaattcgacaattgcgcccgcaaattcttatcggcgtggat
catgaaggcggacgcgtgcagcgttttcgagaaggttttacgctgttgcccgccgccgcg
cagatcgggcggatttttgatcaagatcctgtgatcagttggtctgtagcacaagcgtgc
ggcgtgattttggcttatgaattgcgcgcgcaatccattgatttttcttttgcgccagta
ttggatttatacgatccaaaatcaacggtgattggcgatcgagcgtttcatgaaaatccg
gcaatcgtttccgttttatcttgcagcatgcggcgcggcatgaaaacagttggcatggca
gcggttggcaaacattttccagggcacgggcgcgtcagtggagattctcatcacgagcta
ccaatcgatacgcgcagcgatgcagagcgccgcgcggatctagttccatttatttttaat
gtacagcaggatattgaagctttgatgatggcgcatattttaatgccggacgatacgctg
cccgcgagtttttccgcaaaaataattcaagaattacgcgattggggatttaaaggcgcg
gtggtgagtgatgatttggatatggcagctgcgaaacaatttgcaacgccgacgcaatgc
gtgcaagccgtacttgatgctggcgctgacgcagcaatgatttgtaatcattttgctgat
atggatcgcgtgattgatgaaggcgtcacggttcgcgatagtgcggcatcacaaaaacgt
ttggcgcttttgcgcggcgcagaatatgatgattttgttgctgagcaagcgtatcaaaag
gcgcaagcgacattaacaaagtaccgctcttggtttgtggcataa

DBGET integrated database retrieval system