KEGG   Dichelobacter nodosus: DNO_0213Help
Entry
DNO_0213          CDS       T00517                                 

Gene name
glpK
Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
dno  Dichelobacter nodosus
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:dno00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
229309..230802
Genome map
AA seq 497 aa AA seqDB search
MAKYIIALDQGTTSSRAIIFNHQGEVINISQKDFPQHFPQLGWVEHSPDAIWSTQLSVMQ
EAIAKARIREHDIAAIGITNQRETTMLWNRKTGEPVYQAIVWQDRRTARYCDTLKEEYGA
MIRQKTGLIIDAYFSASKIHWILENVSGARELAEKGDLAFGTVDTWLIWCLTEGKVHVTD
PSNASRTMLFNIHTMQWDDELLALFNIPKAILPEVKSSSEIYGYVDSRYIQGGKVPIAGI
AGDQQAALFGQMCTKKGMMKNTYGTGCFLLMNTGDKIVTSNNNLLSTVAWKIGDKVTYAL
EGGVFVGGAVIQWVRDGLRIIRTADAINSLADTVEDNGGVYFVPCMTGMGAPYWDQYARG
TIIGITRGTTDAHIARATLEGIALQVHDIVRAMEKDVGEATKEFRVDGGASASNLLMQIQ
SDIFQFDIVRPKVLETTALGAAYLAGLAIGFWQNTDEIAQQWQQDCTFSPKMPPEKVAHI
LRYWNKAVKAAQHWIEE
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagtacattattgccttagatcaaggaacaacctcttctcgcgcgattattttt
aaccaccaaggagaagtcatcaatatttctcaaaaagattttccgcagcattttccgcaa
cttggctgggtggaacacagccctgatgcaatttggagtacgcaattatccgtaatgcag
gaagcgattgctaaagcgcgcattcgtgaacacgatattgccgccatcggcattaccaat
cagcgcgaaaccacgatgctatggaatcggaaaacgggcgaaccagtttatcaagccatc
gtttggcaagaccgccgcaccgcgcgttattgtgacacgttaaaagaagaatacggcgcc
atgattcggcaaaaaaccggtttaattatcgatgcttatttttctgccagtaaaattcat
tggattttggaaaacgtttccggcgcgcgcgaacttgccgaaaaaggcgatttagcattt
ggaacggtggatacatggctgatttggtgtttaaccgaaggcaaagtgcacgttaccgat
cccagtaacgccagccggacgatgttatttaatattcatacgatgcaatgggacgatgaa
ttgctcgcgttatttaatattccaaaagcgattttgccggaagtgaaatcctctagcgag
atttatggttacgttgatagccgctatattcaaggcggtaaagtgccgattgccggaatt
gcgggcgaccaacaagcggcgttatttggtcaaatgtgtaccaaaaaaggcatgatgaaa
aacacgtacggcacgggttgttttttattgatgaataccggcgataaaatcgtcacatct
aataataatttgttatcaacggtggcgtggaaaatcggcgataaagtcacttatgctttg
gaaggcggcgtttttgtgggcggcgcggtgattcaatgggtgcgcgatggtttacggatt
attcgcaccgctgatgcgattaatagtttggcagatacggttgaagataacggcggcgtt
tattttgttccgtgtatgacgggcatgggcgcgccttattgggatcaatacgcccgcggc
acgattatcggcattacgcgcggcaccactgatgcgcatattgcccgcgcgacgctggaa
ggcattgctttacaagtgcacgatattgtgcgcgcgatggaaaaagatgtgggcgaggcg
acaaaagagtttcgcgtggacggcggcgcgagcgcgagtaatttattaatgcaaattcaa
tcggatatttttcaatttgacattgtgcgtccaaaagtattggaaacgacggctttgggc
gcggcttatttagccggtttggcaattggtttttggcaaaatactgatgaaattgcccaa
caatggcagcaagattgcactttttcgccgaaaatgccgcccgaaaaagtggcgcatatt
ttgcgttattggaataaagccgtcaaagcggcgcaacattggatcgaggagtaa

DBGET integrated database retrieval system