KEGG   Dichelobacter nodosus: DNO_0213Help
Entry
DNO_0213          CDS       T00517                                 

Gene name
glpK
Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
dno  Dichelobacter nodosus
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dno00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    DNO_0213 (glpK)
Enzymes [BR:dno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     DNO_0213 (glpK)
Exosome [BR:dno04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   DNO_0213 (glpK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
229309..230802
Genome map
AA seq 497 aa AA seqDB search
MAKYIIALDQGTTSSRAIIFNHQGEVINISQKDFPQHFPQLGWVEHSPDAIWSTQLSVMQ
EAIAKARIREHDIAAIGITNQRETTMLWNRKTGEPVYQAIVWQDRRTARYCDTLKEEYGA
MIRQKTGLIIDAYFSASKIHWILENVSGARELAEKGDLAFGTVDTWLIWCLTEGKVHVTD
PSNASRTMLFNIHTMQWDDELLALFNIPKAILPEVKSSSEIYGYVDSRYIQGGKVPIAGI
AGDQQAALFGQMCTKKGMMKNTYGTGCFLLMNTGDKIVTSNNNLLSTVAWKIGDKVTYAL
EGGVFVGGAVIQWVRDGLRIIRTADAINSLADTVEDNGGVYFVPCMTGMGAPYWDQYARG
TIIGITRGTTDAHIARATLEGIALQVHDIVRAMEKDVGEATKEFRVDGGASASNLLMQIQ
SDIFQFDIVRPKVLETTALGAAYLAGLAIGFWQNTDEIAQQWQQDCTFSPKMPPEKVAHI
LRYWNKAVKAAQHWIEE
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagtacattattgccttagatcaaggaacaacctcttctcgcgcgattattttt
aaccaccaaggagaagtcatcaatatttctcaaaaagattttccgcagcattttccgcaa
cttggctgggtggaacacagccctgatgcaatttggagtacgcaattatccgtaatgcag
gaagcgattgctaaagcgcgcattcgtgaacacgatattgccgccatcggcattaccaat
cagcgcgaaaccacgatgctatggaatcggaaaacgggcgaaccagtttatcaagccatc
gtttggcaagaccgccgcaccgcgcgttattgtgacacgttaaaagaagaatacggcgcc
atgattcggcaaaaaaccggtttaattatcgatgcttatttttctgccagtaaaattcat
tggattttggaaaacgtttccggcgcgcgcgaacttgccgaaaaaggcgatttagcattt
ggaacggtggatacatggctgatttggtgtttaaccgaaggcaaagtgcacgttaccgat
cccagtaacgccagccggacgatgttatttaatattcatacgatgcaatgggacgatgaa
ttgctcgcgttatttaatattccaaaagcgattttgccggaagtgaaatcctctagcgag
atttatggttacgttgatagccgctatattcaaggcggtaaagtgccgattgccggaatt
gcgggcgaccaacaagcggcgttatttggtcaaatgtgtaccaaaaaaggcatgatgaaa
aacacgtacggcacgggttgttttttattgatgaataccggcgataaaatcgtcacatct
aataataatttgttatcaacggtggcgtggaaaatcggcgataaagtcacttatgctttg
gaaggcggcgtttttgtgggcggcgcggtgattcaatgggtgcgcgatggtttacggatt
attcgcaccgctgatgcgattaatagtttggcagatacggttgaagataacggcggcgtt
tattttgttccgtgtatgacgggcatgggcgcgccttattgggatcaatacgcccgcggc
acgattatcggcattacgcgcggcaccactgatgcgcatattgcccgcgcgacgctggaa
ggcattgctttacaagtgcacgatattgtgcgcgcgatggaaaaagatgtgggcgaggcg
acaaaagagtttcgcgtggacggcggcgcgagcgcgagtaatttattaatgcaaattcaa
tcggatatttttcaatttgacattgtgcgtccaaaagtattggaaacgacggctttgggc
gcggcttatttagccggtttggcaattggtttttggcaaaatactgatgaaattgcccaa
caatggcagcaagattgcactttttcgccgaaaatgccgcccgaaaaagtggcgcatatt
ttgcgttattggaataaagccgtcaaagcggcgcaacattggatcgaggagtaa

DBGET integrated database retrieval system