KEGG   Dichelobacter nodosus: DNO_0327Help
Entry
DNO_0327          CDS       T00517                                 

Gene name
galU
Definition
UTP--glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
dno  Dichelobacter nodosus
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dno00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    DNO_0327 (galU)
   00052 Galactose metabolism
    DNO_0327 (galU)
   00500 Starch and sucrose metabolism
    DNO_0327 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    DNO_0327 (galU)
Enzymes [BR:dno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     DNO_0327 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
349622..350512
Genome map
AA seq 296 aa AA seqDB search
MVTDKINLAVFPVAGFGTRFLPATKSTPKEMLPVVDKPLIQYAVEEAYDAGIRNMVFVTG
RNKWSITEHYDVAFELESELQAKNKTEFLQLVRQIKPKDMNVIFIRQEMMLGLGHAVLCA
EPVVRNRPFAVLLADDLVANPDGAPVMKQMVELYEKHQQGVIGVQEILPEHTKRYGIITE
AAKLDERTSMIAGVVEKPEPEVAPSRLAIIGRYILPGQIMEVLKTTPKGAGGEIQLTDAI
AVLIQQKTLLAYRFLGKRYDCGDKLGYLQANVEFGLAHPQFGSDFKAYLQSLSFTE
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atggtaacggataagattaatttagcggtttttccagttgcaggttttggaacacgtttt
ttgccggcaacaaaatccaccccgaaagaaatgctgccggtggtggataaacctttgatt
caatacgcggttgaagaagcatatgatgccggaattcgcaatatggtttttgtaaccggt
cgcaataaatggtcaattaccgaacattatgatgttgcttttgaattagaaagcgaattg
caggcgaaaaataaaaccgaatttttgcaattggtgcgccaaatcaagcccaaagatatg
aacgttatttttattcgtcaggaaatgatgttgggattgggacatgccgtgttatgcgcg
gagccggtggtgcgtaatcgtccttttgcggtgttattagccgatgatttggtagccaat
ccagatggcgcgcccgtgatgaagcaaatggttgaattatatgaaaaacatcaacaaggc
gtgatcggtgtacaagaaattttaccggaacatacgaaacgttacggcatcattaccgaa
gcagctaaactcgatgaacgcacttccatgattgccggcgtggtggaaaaacccgagcca
gaagtggcgccgtcgcggctggcaattattggacgctatattttgcccggacaaattatg
gaagttttaaaaaccacgccaaaaggtgccggcggcgaaattcagttaaccgatgcgatt
gccgtattaattcaacaaaaaacattattggcttaccgctttttaggcaaacgctacgat
tgcggcgataaattgggctatttacaagccaacgtagaatttggtttagcgcacccacaa
tttggcagcgattttaaagcttatttgcaaagcctttcttttaccgaataa

DBGET integrated database retrieval system