KEGG   Dichelobacter nodosus: DNO_0331Help
Entry
DNO_0331          CDS       T00517                                 

Gene name
sucB
Definition
2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
dno  Dichelobacter nodosus
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:dno01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:dno00020]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:dno00310]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
353831..354856
Genome map
AA seq 341 aa AA seqDB search
MSTEVKIPTLPESVSDAILVNWHKSVGDFVEQGENLIDLETDKVMLEMPAPVSGIIAEIL
QEDGMTVISGQVIARIEEQKQQHEVPPAKKITIEEPVITEPSAAEHFPLSMEERVPMSRL
RKKISERLLNVQQTTAMLTTFNEINMQAVMNYRHDFQNDFVKKYGVKLGLMSFFVRAAVA
ALRQFPVINAMIDGDDVVYRRYCNIGIAVASPRGLVVPILRNAETLSFADIERQIKIFAE
KAADGSLSLEEISDGTFTITNGGTFGSMLSTPILNPPQSAILGMHAIVDRPMVENGAIVI
RPVMYVALSYDHRLIDGREAVLFLKTIKNMLEAPARLLLDL
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgagtactgaagttaaaattccaactttacccgaatctgtttctgatgccattttggtg
aattggcataaaagcgttggggattttgtggagcagggcgaaaatttaatcgatttggaa
acggataaagtaatgctggaaatgccggcgccggtcagcggcattatcgcggagattttg
caagaagacggtatgacggttatcagtggacaagttatcgcgcgtattgaagaacaaaag
cagcaacacgaagtgccgccggcgaaaaaaatcacaatagaagaacccgttattaccgaa
ccgtcagcggcagagcatttcccgttatcgatggaagaacgcgtgccgatgagtcgtttg
cgcaaaaaaatcagcgaacggttgttaaatgtgcaacaaaccacagcgatgttgacgacg
tttaacgaaatcaatatgcaggcggtgatgaattatcgccatgattttcaaaatgatttt
gttaaaaaatacggcgttaaattaggattgatgagctttttcgtgcgcgcggcggtggcg
gctttgcggcaatttcccgtgattaatgccatgattgatggtgatgatgtggtgtatcgg
cgttattgcaatattggcattgcagttgcgagtccacgcggattggtggtaccgattttg
cgcaacgccgaaacgttgagttttgccgatattgagcggcaaatcaaaatctttgccgaa
aaagctgccgacggttcattatctttggaagaaatcagcgacggtacttttacaattacc
aacggcggtacttttggttcgatgttatcaacgccgattttaaatccgccgcaaagcgcg
attttgggcatgcatgcaattgttgaccgacctatggtggaaaatggtgcgatcgtgatt
cgtcctgtgatgtacgtagcgttgagttatgatcaccgtttaatcgatgggcgcgaggca
gttttgtttttgaaaacgattaaaaatatgcttgaggcgccggcgcgattattgttagac
ctttaa

DBGET integrated database retrieval system