KEGG   Dichelobacter nodosus: DNO_0331Help
Entry
DNO_0331          CDS       T00517                                 

Gene name
sucB
Definition
2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
dno  Dichelobacter nodosus
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:dno00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    DNO_0331 (sucB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    DNO_0331 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    DNO_0331 (sucB)
Enzymes [BR:dno01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     DNO_0331 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
353831..354856
Genome map
AA seq 341 aa AA seqDB search
MSTEVKIPTLPESVSDAILVNWHKSVGDFVEQGENLIDLETDKVMLEMPAPVSGIIAEIL
QEDGMTVISGQVIARIEEQKQQHEVPPAKKITIEEPVITEPSAAEHFPLSMEERVPMSRL
RKKISERLLNVQQTTAMLTTFNEINMQAVMNYRHDFQNDFVKKYGVKLGLMSFFVRAAVA
ALRQFPVINAMIDGDDVVYRRYCNIGIAVASPRGLVVPILRNAETLSFADIERQIKIFAE
KAADGSLSLEEISDGTFTITNGGTFGSMLSTPILNPPQSAILGMHAIVDRPMVENGAIVI
RPVMYVALSYDHRLIDGREAVLFLKTIKNMLEAPARLLLDL
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgagtactgaagttaaaattccaactttacccgaatctgtttctgatgccattttggtg
aattggcataaaagcgttggggattttgtggagcagggcgaaaatttaatcgatttggaa
acggataaagtaatgctggaaatgccggcgccggtcagcggcattatcgcggagattttg
caagaagacggtatgacggttatcagtggacaagttatcgcgcgtattgaagaacaaaag
cagcaacacgaagtgccgccggcgaaaaaaatcacaatagaagaacccgttattaccgaa
ccgtcagcggcagagcatttcccgttatcgatggaagaacgcgtgccgatgagtcgtttg
cgcaaaaaaatcagcgaacggttgttaaatgtgcaacaaaccacagcgatgttgacgacg
tttaacgaaatcaatatgcaggcggtgatgaattatcgccatgattttcaaaatgatttt
gttaaaaaatacggcgttaaattaggattgatgagctttttcgtgcgcgcggcggtggcg
gctttgcggcaatttcccgtgattaatgccatgattgatggtgatgatgtggtgtatcgg
cgttattgcaatattggcattgcagttgcgagtccacgcggattggtggtaccgattttg
cgcaacgccgaaacgttgagttttgccgatattgagcggcaaatcaaaatctttgccgaa
aaagctgccgacggttcattatctttggaagaaatcagcgacggtacttttacaattacc
aacggcggtacttttggttcgatgttatcaacgccgattttaaatccgccgcaaagcgcg
attttgggcatgcatgcaattgttgaccgacctatggtggaaaatggtgcgatcgtgatt
cgtcctgtgatgtacgtagcgttgagttatgatcaccgtttaatcgatgggcgcgaggca
gttttgtttttgaaaacgattaaaaatatgcttgaggcgccggcgcgattattgttagac
ctttaa

DBGET integrated database retrieval system