KEGG   Dichelobacter nodosus: DNO_0408Help
Entry
DNO_0408          CDS       T00517                                 

Gene name
recD
Definition
exonuclease V, alpha subunit (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
dno  Dichelobacter nodosus
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:dno00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    DNO_0408 (recD)
Enzymes [BR:dno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     DNO_0408 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
450954..452528
Genome map
AA seq 524 aa AA seqDB search
MPINDTDKNHFIGAFLAQRAGGCSENFVPHFERVMTAIAAGNTVVAAENAIADGALIVTA
DAAKKGAVAPLVSDGTFLWLYRLWFQEWRLASCIQKKLNAADDSILEHNSFDDGLNAEQK
QALKMGLTRQLSIINGGPGTGKTFTVARIVAALLARDPDLTIALAAPTGKAAQRLEIALH
QAFITAQLTRPTQLTTAQTVHRLLGVDNTGTARYHEHYFLPYDVVIIDEASMLSLELAAQ
LFQALAPHTRIILLGDAQQLAAVEAGAVLHDLAQQSALNHHVVTLQESRRFHQTSGIGIL
ARCTQNASQTALTAALEHEDIALSPLARRPNYDRLYEPYRDYVAKVAAGAAVDVLLQQFD
NYRILTKTRYGAYGTAAVNEQMKKRHLAQMGVNGKRAFYQGAPVMVTRNNYAHGVFNGDI
GICLADERGQMLVYFREDFAVPLLFLKSDDLDFAYALTIHKAQGSEFEQVALLLDKQEEG
LTRELVYTGITRAKKQLLLETTPAILLKAMQTPTQRLTGLSTFF
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atgccaatcaatgatacggacaaaaatcattttatcggcgcgtttttagcacaaagggcg
ggcggttgttcggaaaattttgtgcctcattttgaacgcgtgatgacggcaatcgctgcc
ggaaatacggtagttgccgcagaaaatgcgattgccgacggcgcgttaattgtaacggca
gatgcggcaaaaaagggcgcggtggcgccgttggttagtgatggtacttttttatggctt
tatcggctgtggtttcaggagtggcgtttggcgagttgcattcaaaaaaaattaaatgcc
gccgacgattctattttggaacataattcatttgatgacggtttaaatgccgaacaaaag
caagcgcttaaaatgggattgacgcggcaattaagcattattaatggcgggccgggtacg
ggaaaaacgtttaccgtggcgagaatcgttgccgctttattggcacgagatcccgattta
acaattgcattagccgcgccaacgggaaaagcggctcaacgtttggaaatcgcgttgcat
caggcttttataacggcgcaattaacgcgtccgacgcaacttaccaccgcgcagacggtg
catcgtttattgggcgtggataacacgggaacggcgcgttatcacgaacattatttttta
ccgtatgacgtggtgattatcgatgaagcttcgatgctgtcgctagaattagccgcgcaa
ttgtttcaagcgctggcgccgcatacccgcatcattttattaggcgatgcgcagcaatta
gccgcggtggaggcgggcgcggtgttgcatgatttggcgcaacaatcagcgttaaatcat
catgtggtgacgttacaagaatcacggcgttttcatcaaacatcgggcattgggattttg
gcgcggtgcacacaaaatgcatcgcaaacggcgttaaccgcggcgttagagcacgaagat
attgctttatcaccgttggcgcggcgcccgaattatgatcgtttatatgaaccatatcgc
gattatgtggcaaaggtggcggcgggcgcggcggttgatgttttattacaacagtttgat
aattatcgtattttaacgaaaacacgttatggtgcgtacggaacggcggcggtgaatgag
cagatgaaaaagcggcatttagcgcagatgggcgttaacggaaaacgcgctttttatcag
ggcgctccggtgatggtgacgcgcaataattatgcgcacggcgtttttaatggcgatatt
ggcatttgtcttgccgatgagcggggacagatgttggtttattttcgtgaagatttcgct
gtgccgttattgtttttaaaatcggatgatttggattttgcttatgcgttaacgattcat
aaagcacaggggtcggaatttgagcaggtagcgttattgttggataaacaggaagaaggt
ttgacgcgggaattagtttatacgggcattacgcgggcaaaaaaacaattattgcttgag
acgacgccggcaattttattaaaagccatgcaaacacccacgcaacgtttaacaggttta
tccacttttttttaa

DBGET integrated database retrieval system