KEGG   Dichelobacter nodosus: DNO_0528Help
Entry
DNO_0528          CDS       T00517                                 

Gene name
glmS
Definition
glucosamine-fructose-6-phosphate aminotransferase (EC:2.6.1.16)
Orthology
K00820  
glucosamine--fructose-6-phosphate aminotransferase (isomerizing) [EC:2.6.1.16]
Organism
dno  Dichelobacter nodosus
Pathway
Alanine, aspartate and glutamate metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:dno00520]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:dno00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
562630..564447
Genome map
AA seq 605 aa AA seqDB search
MCGIIAGVAKKDIVSILMTGLTRLEYRGYDSAGIAVLSKNKLHCRRAVGKVMQLTEKIAE
SPLAGNSGIAHTRWATHGIPNEKNAHPHISGAQIAVVHNGIIENYLELRAQLIEKGYQFQ
SDTDSETIAHLIHDYYQRDHDIAAAVLHTLPHLKGSYALAVMAADDPDHIVVACQHSPMI
IGKSAAGYFAASDSFALLPLMRQFIYLQDGDVAQLSREDCRIFDHSGKSVQRVWVESEQD
DDIVGKNGYQHFMQKETFEQPSVIRHTLSGRLTAQSLNIDTFSPELQEICNQLKNIDIIA
CGSSYHAGLVVKYYLEAAGIRTNVEYASEYLYRDVAVSPHTLFLTISQSGETADTLAALN
KAKKLPYLDYLAVCNVAESALVRLCPHHILTRAGREIGVASTKAFMAQLVVLHLITLLIR
HVKGENISEECAALARLPAAVEQMLALDTKIAAAAKTLQKERNCLFLGRGAGAAIAAEGA
LKLKELSYIHAEAYPCGELKHGPLALVDEQMTVVAVVQAGLLGEKTLSNLQEVQARGGRL
IVFADERVDLHALSDATVISLGVLDDLTMALIAVVPLQLFAYHVACYKGNDVDQPRNLAK
SVTVE
NT seq 1818 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggaattattgccggtgtggcaaaaaaagatattgtttcaattttgatgacggga
ctcacgcgtttggaataccgtggctacgattctgctggaatcgccgtattatcaaaaaat
aaactccattgtcgccgtgccgtaggaaaagtgatgcaattaaccgaaaaaattgccgaa
tcgccgcttgccggcaacagcggcattgctcatacccgttgggcaacgcacggcattccc
aacgaaaaaaacgcccacccacacatcagcggcgcgcaaattgccgttgttcataatggc
attattgaaaactatcttgaattacgcgcgcaattaatcgaaaaaggatatcaatttcaa
tcggataccgattcagaaaccatcgcgcatttaattcatgattattatcaacgcgatcac
gatatcgctgccgccgttttgcatactttgccgcatttaaaaggcagttatgcgctcgcg
gtgatggcggcagatgatcccgatcatatcgttgttgcttgccaacattctccgatgatt
atcggcaaaagcgcggcgggctattttgccgcatctgatagttttgctttattgccgctg
atgcgccaatttatttatttacaagacggcgacgtggcgcaattaagccgcgaggattgc
cgcatttttgatcacagcggaaaatccgtgcaacgcgtttgggttgaaagtgaacaagat
gatgatattgttgggaaaaatggttatcaacattttatgcaaaaggaaacgtttgagcag
cccagcgtaattcgtcatactttatcaggacgtttaaccgcgcaatcgttaaatatcgat
acgttttctccagaattacaagaaatatgtaatcaattgaaaaatattgatattatcgct
tgcggcagcagttatcacgctggtttagtggttaaatattatcttgaagccgcgggcatt
cgcacaaatgttgaatacgccagcgaatatttataccgcgatgttgccgtttcgccgcat
actttatttttaaccatttctcaatctggagaaacggctgatactttagccgcgctcaat
aaagccaaaaaattaccttatttggattatttagcggtatgcaatgttgctgaaagtgcg
ctggtgcgcttgtgtccgcatcatattttaacgcgcgccggtcgggaaattggcgtggct
tccactaaagcttttatggcgcaattggttgtgttgcatttaattactttattgattcgt
cacgttaaaggagaaaatatcagcgaagaatgcgctgctttagcgcgtttgccggctgcc
gttgagcaaatgttagcgttggatacaaaaattgctgcggcggcaaaaacattgcaaaaa
gagcgcaattgtttgtttttaggacgcggcgccggcgcagcaattgcggcagaaggcgcg
ttaaaattaaaagaattatcttatatccacgcggaagcttatccctgcggcgaattaaag
catggacctttggctttggttgatgaacaaatgactgtagttgctgttgtgcaggcagga
ttattgggcgaaaaaacattgagtaatttgcaagaagtgcaggcgcgcggcggacgtttg
atcgtttttgctgatgaacgcgttgatttacacgctttatccgatgccacggtgatttct
ttgggcgtgttagacgatttgacgatggcattaatcgcagtagtgccgttacaattattc
gcttatcatgttgcttgttataagggaaatgacgttgaccagccgcgaaatttagcgaaa
tcggtgacggtagaataa

DBGET integrated database retrieval system