KEGG   Dichelobacter nodosus: DNO_0706Help
Entry
DNO_0706          CDS       T00517                                 

Definition
phosphoglycerate mutase (EC:5.4.2.1)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
dno  Dichelobacter nodosus
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:dno00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    DNO_0706
   01230 Biosynthesis of amino acids
    DNO_0706
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DNO_0706
  Energy metabolism
   00680 Methane metabolism
    DNO_0706
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    DNO_0706
Enzymes [BR:dno01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     DNO_0706
Exosome [BR:dno04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   DNO_0706
  Exosomal proteins of melanoma cells
   DNO_0706
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
760865..761605
Genome map
AA seq 246 aa AA seqDB search
MKKLVLVRHGQSQWNLENLFTGWTDVDLTEQGQKEAATAAQLLQKEGIFFQTAFTSYLKR
AIKTLNIILDVMDLDWIDVHKTWRLNEKHYGALQGLNKKETAAQYGQEQVLLWRRSFDTA
PAALEYSDARAPHNDRRYQRVARQDLPLTESLKDTIARIMPYWEVVIKPVLIAENTVLIV
AHGNSLRAIIKHLKGISETEITDLNLPTGIPYVFEFDDDMNLCADYFLGDTEAIKKLQES
VAKQSQ
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaattagtattagtgcgccacgggcaaagtcagtggaatttagaaaatttgttt
accggttggacggacgttgatttaacagaacaaggtcaaaaggaagccgcgacagccgcg
caattgttacaaaaagagggtattttttttcaaacggcttttacttcttatctaaaacgc
gcgataaaaacgctcaatattattttagatgtgatggatttggattggattgatgtccac
aaaacgtggcgcttaaatgaaaaacattatggcgcgttgcaaggactcaataaaaaagaa
accgcggcgcaatacggtcaagaacaagtattattgtggcggcggagttttgacacggcg
ccggcagcgctggaatattctgatgcgcgcgcgccgcataatgatcgccgttatcaacgc
gttgcgcggcaggatttaccgctgacggaatcgttaaaagatacgattgcgcgcattatg
ccttattgggaagtggtgataaaaccggttttaattgcggaaaatacggttttaattgtg
gcgcacgggaacagtttgcgcgcgattattaagcatttaaaaggcatttccgaaacggaa
attaccgatttgaatctgccaacgggtattccttatgtttttgaatttgacgatgatatg
aatctttgcgcggattattttttaggcgataccgaagcgattaaaaaattacaagaatcc
gttgccaaacaatcgcaataa

DBGET integrated database retrieval system