KEGG   Dichelobacter nodosus: DNO_0789Help
Entry
DNO_0789          CDS       T00517                                 

Gene name
folA
Definition
dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
dno  Dichelobacter nodosus
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:dno00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:dno00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
832328..832822
Genome map
AA seq 164 aa AA seqDB search
MPKPKIHLIAAQTLNRVIGKDGGMPWHLPRDLQHFKQRTSGHTIIMGRKTFQSLKKPLPN
RKNIVISHSGQPLHADVAVFPAISEALAFCCNDEKVFIIGGGSLYAATIDEADFLTITWI
HTELLGDTFFPPIRPQDWQETHRSHFAADAKNAFALDFVDYQRR
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atgccgaagcctaaaatacatttaattgccgcgcaaactttaaaccgcgtcatcggaaaa
gatggcggtatgccgtggcatttgccgcgcgatttgcagcatttcaaacaacgcaccagc
ggacataccatcatcatggggcgcaaaacgtttcaaagtttaaaaaagccattgcccaat
cgcaaaaatattgtcatcagccacagcgggcaaccgttgcatgctgatgtcgccgttttt
cctgctatttcagaagcattggctttttgttgcaatgatgaaaaagtatttattatcgga
ggcggtagtttgtatgcggcaacgattgatgaagcggattttttaacgataacgtggatt
cataccgaactgttgggcgatacttttttccccccgattcgacctcaagattggcaagaa
acgcaccgcagccattttgccgcggacgcgaaaaacgcatttgcgctcgattttgtcgat
tatcaacggcgttag

DBGET integrated database retrieval system