KEGG   Dichelobacter nodosus: DNO_0814Help
Entry
DNO_0814          CDS       T00517                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
dno  Dichelobacter nodosus
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:dno00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    DNO_0814 (tpiA)
   01230 Biosynthesis of amino acids
    DNO_0814 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DNO_0814 (tpiA)
   00051 Fructose and mannose metabolism
    DNO_0814 (tpiA)
   00562 Inositol phosphate metabolism
    DNO_0814 (tpiA)
Enzymes [BR:dno01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     DNO_0814 (tpiA)
Exosome [BR:dno04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   DNO_0814 (tpiA)
  Exosomal proteins of bladder cancer cells
   DNO_0814 (tpiA)
  Exosomal proteins of melanoma cells
   DNO_0814 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(855506..856231)
Genome map
AA seq 241 aa AA seqDB search
MRKPIAAANWKMNGDFSLLDDFAQANITSDKCETIFALPSVLLDRAQKLGLNALAGQDVS
AQVKGAFTGEISASMLKMLGCQYCIIGHSERRQYHHEDEALLIEKWRRLKEAEITPIYCI
GELQAEYDAHATQQALERQLRPILEENLVDHKTIIAYEPVWAIGTGKAATPDYAQHVHQM
IRQIVAQNYASIAPAMRLLYGGSVKPDNAGLLICQADIDGFLIGGASLDVGLFTKIIETM
K
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaaacccattgctgcggcaaattggaagatgaatggcgatttttctttattagat
gattttgctcaagccaatataacgtcagataaatgtgaaacgatttttgcgttaccgtca
gttttgctcgatcgggcacaaaagttgggtttgaacgctttggcgggtcaagatgtttcc
gcgcaagtaaaaggtgcgtttacgggcgaaatttctgcatcaatgcttaaaatgttgggg
tgtcagtattgcattattggtcattcagaacggcggcagtaccatcatgaagatgaagca
ttgttgattgaaaaatggcgccgattaaaagaagccgagatcactccgatttattgcatc
ggcgaattgcaggcggaatatgatgcgcacgcaactcagcaagcgttggagcgtcaattg
cgcccgattttggaagaaaatcttgttgatcacaaaacgattatcgcttatgaacccgtt
tgggcaattggcactggcaaagctgcaactccagattacgcgcaacatgttcatcaaatg
attcggcaaatcgttgcgcaaaattatgctagtatagcgcccgcaatgcggctgctttat
ggcggtagtgttaagcccgacaacgcaggtttgctcatctgtcaagccgatattgatggt
tttttaatcggtggcgcttccttagatgttggtttgtttacaaagattattgagacgatg
aaatga

DBGET integrated database retrieval system