KEGG   Dichelobacter nodosus: DNO_0986Help
Entry
DNO_0986          CDS       T00517                                 

Gene name
murE
Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
dno  Dichelobacter nodosus
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:dno00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    DNO_0986 (murE)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    DNO_0986 (murE)
Enzymes [BR:dno01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     DNO_0986 (murE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1028165..1029613)
Genome map
AA seq 482 aa AA seqDB search
MKTTHELLTALGLSTAAVDDKPISALSLDSRVLNEQMLWLATRGTQYHALDFYTPEINCA
AIFYEPPYQNPPPHAITVERLSEKVSAIADLFYDHPAQKLWITGVTGTDGKSSLVHFIAQ
ATGAAMLGTIGYGNLNALQPASHTTPDAITTQQQLAHFVAQGNQAVAMEISSHALAQHRV
AAVAVDVAVFTNLSRDHLDYHADMEDYFLAKAQLFAFPIKHAVINIDDPHGRRLISEHRI
NSSACIWAVSAKGAHNAAAHHNVCAHDYCLHQNGVTFTLAIDDETIAVETHLLARFNLDN
VLNVAACLAAQGFSLAAIAEKLNQLHGVIGRVEPISLSNQALAIVDYAHTAGAIESVLTG
IRPHISGKLWLIFGCGGNRDRGKRALMAQAAERFADAVIVTDDNPRTEDPAAIIADVMQG
FEYPEKIHVIQPREQAIHYALAQLHAGDAVLITGKGHEDYQIIGTTKYPFSDQAVIKAWI
NP
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaccacccatgaattgttaacggcattgggattgtcaaccgccgccgttgacgat
aaacccatctccgcgttgagtcttgattcgcgcgtccttaatgaacaaatgctttggctt
gccacccgtggcacgcaatatcacgcgcttgacttttatacgccagaaataaattgtgcg
gcgattttttatgaaccgccttatcaaaatccgccgccacatgcgattacggtggaacga
ttgagcgaaaaagtcagtgctattgctgaccttttttatgatcaccccgcccaaaaatta
tggataacgggtgtgactggcacggacggcaaatcatcattggtgcattttatcgcgcag
gcgacgggtgccgcgatgttgggcacgatcggttatggcaatttaaatgcgttgcaaccc
gccagccacaccacgcctgatgccatcacaacgcaacaacaattagcccattttgttgcg
cagggcaatcaagccgtggcaatggaaatttcttcacacgctttagcgcaacatcgcgtg
gcagcggtggcagtagacgttgccgtttttacgaatttaagccgcgatcacctcgattat
cacgcggatatggaagattattttttggcaaaagcgcagttatttgcgttccccatcaaa
cacgccgttatcaatattgatgatccgcacggcagacgattaatcagcgagcaccgcatt
aattcttcggcgtgcatttgggcagtttctgcaaaaggcgcgcacaatgccgccgcgcat
cataacgtttgcgcgcatgattattgtctgcatcaaaatggcgttacttttaccttggca
attgatgatgaaacgatcgccgtggaaacgcatttattagcgcgctttaatcttgataac
gttttaaacgttgccgcttgtttagcagcgcaaggattttctttggcagcaattgccgaa
aaattgaatcaattgcatggcgtgattggacgcgttgaaccgatttcattgtccaatcaa
gcgcttgccatcgttgattacgcgcatactgccggcgcgattgaaagcgtgttaacgggt
attcgtccgcatatttccggaaaattatggttaatttttggttgcggcggcaatcgcgat
cgtggcaaacgtgcattaatggcgcaagcggcagaacgttttgccgatgccgttatcgtt
accgatgacaatccgcgcaccgaagatccagcggcaattattgcagacgtaatgcaagga
tttgaatatccagaaaaaattcatgttattcaaccgcgcgagcaagcaattcattatgcg
cttgctcaattgcacgccggcgatgcggttttaattactggaaaagggcacgaagattat
caaattatcggcacgaccaaatatcctttttctgatcaagccgtgattaaagcgtggata
aacccatga

DBGET integrated database retrieval system