KEGG   Dichelobacter nodosus: DNO_1177Help
Entry
DNO_1177          CDS       T00517                                 

Gene name
ruvA
Definition
Holliday junction ATP-dependent DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
dno  Dichelobacter nodosus
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:dno00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    DNO_1177 (ruvA)
Enzymes [BR:dno01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     DNO_1177 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1223419..1224033)
Genome map
AA seq 204 aa AA seqDB search
MIGWLQGRVLYKQNDQLLINVCGVGYELTVPQSVMASAQVGEELTVFVHHVQREDGQFLY
GFSSFLQRQLFRELIRVSGIGPKLSIVILSGLTPEALIAAVRAQESAPFLRLSGIGKKTA
ERLLIELHDRVEKNDLFLCDESESSRAPIALSASEEAIQALIALELAPAEAELWVKKAQK
TLAEDADSAALIKTAFALRLQGAK
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgatcggttggcttcaggggcgcgttttatacaaacaaaacgatcaattattgattaac
gtttgtggtgtaggttatgaattaaccgtaccgcaatcggtgatggcgtctgcgcaagtg
ggcgaagaattaacggtttttgtgcaccacgttcagcgagaagacggtcaatttctctat
ggtttttcttcttttttgcaacgccaactattccgcgaattaattcgcgtgagcggtatt
ggtccgaaattatccattgtgattttgtcgggattgacgccagaagctttgattgccgcg
gtgcgcgcgcaagaaagcgcgccttttttgcgtttatcgggcatcggtaaaaaaacggca
gagcgcttgttaatcgaattgcacgatcgcgtggaaaaaaacgatttatttttatgcgat
gaaagcgaatcgtcgcgcgcgcccatagcgctttccgcttcagaagaagccattcaagcg
ctgattgctttagaactcgcgccggcggaagcggaattgtgggttaaaaaagcgcaaaaa
acgctcgctgaagatgccgatagtgccgcgttaattaaaacggcgtttgcattacgttta
cagggggcaaaatga

DBGET integrated database retrieval system