KEGG   Dichelobacter nodosus: DNO_1237Help
Entry
DNO_1237          CDS       T00517                                 

Gene name
folP
Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
dno  Dichelobacter nodosus
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:dno00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1279319..1280170)
Genome map
AA seq 283 aa AA seqDB search
MAQLWQCGRFSLDFQQTKIMGILNCTPDSFSDGGRFFAPDDALAHAMQMIADGAEIIDVG
AESTRPGSAAIDVKEEIRRLTPVVTELVADGRCVVSVDTKNAATMRAMLDLGVDLINDVH
GLEDPDAVDAVKESRCGICLMHMRGMPENMQEDTRYSDVVAEVDRYLQERVDVCRAAGIA
DNRLMLDPGFGFGKTPEQNMQLFLQGRNYAAAKYPVLLGVSRKSTIGHYLGGRPVNDRLI
GSVTLAAWAAWHDVAVVRVHDVRETRDALLMVEALKKIEKDHK
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atggcacaattatggcaatgtgggcgtttttcgcttgattttcaacaaactaaaatcatg
ggtattttgaattgtacgccggattctttttctgacggcggacgcttttttgctcccgat
gatgctttggcgcatgccatgcagatgattgctgatggtgcggaaattattgatgtgggt
gcggaatcaacgcgccccggttcggcggcaattgatgttaaagaagaaattcgccgttta
acgccggttgtgacggagttggttgccgatgggcgttgcgtggtatccgtggatactaaa
aacgcggcaacgatgcgggcaatgttagatttgggcgtggatttaattaacgatgtgcac
ggattagaagatcctgatgcggttgatgcggtgaaagaaagtcgctgcggtatttgcttg
atgcatatgcgtggtatgccggaaaatatgcaggaagatacgcgttatagcgatgttgtg
gctgaagtggatcgttatttgcaagaaagggttgacgtttgtcgggcggcggggattgct
gataatcgtttgatgctggatccaggttttggttttgggaaaacgcctgaacaaaatatg
caattgtttttacaaggcagaaattatgcggcagcaaaatatccggttttgctgggcgtt
tcgcgaaaatcaacaatcggacattatttgggcggtcgtccggtaaacgatcggctgatt
ggcagcgtgactttagcggcgtgggcagcgtggcatgatgttgctgtggtgcgtgtgcac
gatgttcgggagacgcgcgatgcgttattaatggtagaagcgttgaaaaaaatagaaaag
gatcataaatga

DBGET integrated database retrieval system