KEGG   Dichelobacter nodosus: DNO_1312Help
Entry
DNO_1312          CDS       T00517                                 

Gene name
suC
Definition
(RefSeq) succinyl-CoA synthetase, beta subunit (EC:6.2.1.5)
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
dno  Dichelobacter nodosus
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:dno00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    DNO_1312 (suC)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    DNO_1312 (suC)
   00640 Propanoate metabolism
    DNO_1312 (suC)
   00660 C5-Branched dibasic acid metabolism
    DNO_1312 (suC)
Enzymes [BR:dno01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     DNO_1312 (suC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1339831..1340991
Genome map
AA seq 386 aa AA seqDB search
MNLHEYQAKALLRAAGIKTPRGIIIKNSVEAKEAAQQLGGNRWVVKAQIHSGGRGKAGGI
KTAQTLDEVHHISAAMLGSRLKTEQSSADGLPINEVLIEEECRAIATYYLALTLDRPRQQ
IVFIASMAGGTEIETVAETNPEAIIYAGVNPAIGFSPYLSARVGGALQLDKSYQLPLTKL
MNRLYQLFIDNDLTLLELNPLIITEDHEFLPLDAKISIDDNALFRHQELVDLRDTTQEDH
RETQAQELQLNYVPLDGTIGCIANGAGLAMATMDIIKLYGGEPANFLDVGGDATSERVKQ
AFKLILTSSRIKSILVNIFGGIVRCDLIADGIIQAAKEIDLKIPVIVRLQGNNVDLGRKM
LDECPLNLQAADDLIDAAQKAIAAAQ
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgaatctacacgaatatcaagcaaaagcgctacttcgcgctgccggcatcaaaacgccg
cgcggcatcatcattaaaaacagtgtggaagcaaaagaagccgcgcaacagttaggcggc
aatcgttgggtcgttaaagcacaaatacattccggcggacgcggtaaagccggcggcatc
aaaactgcgcaaacgctcgatgaagtgcaccatatcagcgccgcaatgctcggaagtcgt
ttaaaaacggaacaaagcagcgctgacggtttacccatcaatgaagtattaattgaagaa
gaatgccgcgccatcgccacttattatcttgctttaacgctcgatcgcccgcgccaacaa
atcgtttttatcgcatcaatggcaggcggaaccgaaatcgaaaccgtcgccgaaacaaat
cctgaagcaattatttatgccggtgtcaatccagccatcggattttctccttatctttct
gcgcgcgttggcggcgcactgcaactggataaatcctatcaattgccgcttacaaaactg
atgaatcgtctttaccaattatttattgataacgatttaacgctactcgaactcaatccg
cttatcatcaccgaagatcacgaatttttaccgcttgacgctaaaatcagcatcgatgat
aacgcgctctttcgtcatcaagaattggtggatttacgcgacacaacgcaggaagatcac
cgcgaaacgcaggctcaagaattgcaattaaattatgttccgctcgacggtaccatcggc
tgcatcgcaaacggcgcaggtcttgccatggcaaccatggacatcattaaactgtacggc
ggtgaaccggcaaactttttagatgttggcggtgatgccacatcagaacgcgttaaacaa
gcctttaaactcattttgacgtcatcgcgcatcaaatccattttggtcaatatttttggc
ggtattgtccgctgcgatttaatcgccgacggcatcattcaagcggcaaaagaaatcgat
ttaaaaattcccgtcatcgtgcgtttacaaggcaataatgttgatctcgggcgcaaaatg
ctcgacgaatgtccgttaaatttgcaagctgcggacgatttaatcgatgcggcgcaaaaa
gccatcgcggcagcacaataa

DBGET integrated database retrieval system