KEGG   Dichelobacter nodosus: DNO_1312Help
Entry
DNO_1312          CDS       T00517                                 

Gene name
suC
Definition
succinyl-CoA synthetase, beta subunit (EC:6.2.1.5)
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
dno  Dichelobacter nodosus
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:dno00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    DNO_1312 (suC)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    DNO_1312 (suC)
   00640 Propanoate metabolism
    DNO_1312 (suC)
   00660 C5-Branched dibasic acid metabolism
    DNO_1312 (suC)
Enzymes [BR:dno01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     DNO_1312 (suC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1339831..1340991
Genome map
AA seq 386 aa AA seqDB search
MNLHEYQAKALLRAAGIKTPRGIIIKNSVEAKEAAQQLGGNRWVVKAQIHSGGRGKAGGI
KTAQTLDEVHHISAAMLGSRLKTEQSSADGLPINEVLIEEECRAIATYYLALTLDRPRQQ
IVFIASMAGGTEIETVAETNPEAIIYAGVNPAIGFSPYLSARVGGALQLDKSYQLPLTKL
MNRLYQLFIDNDLTLLELNPLIITEDHEFLPLDAKISIDDNALFRHQELVDLRDTTQEDH
RETQAQELQLNYVPLDGTIGCIANGAGLAMATMDIIKLYGGEPANFLDVGGDATSERVKQ
AFKLILTSSRIKSILVNIFGGIVRCDLIADGIIQAAKEIDLKIPVIVRLQGNNVDLGRKM
LDECPLNLQAADDLIDAAQKAIAAAQ
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgaatctacacgaatatcaagcaaaagcgctacttcgcgctgccggcatcaaaacgccg
cgcggcatcatcattaaaaacagtgtggaagcaaaagaagccgcgcaacagttaggcggc
aatcgttgggtcgttaaagcacaaatacattccggcggacgcggtaaagccggcggcatc
aaaactgcgcaaacgctcgatgaagtgcaccatatcagcgccgcaatgctcggaagtcgt
ttaaaaacggaacaaagcagcgctgacggtttacccatcaatgaagtattaattgaagaa
gaatgccgcgccatcgccacttattatcttgctttaacgctcgatcgcccgcgccaacaa
atcgtttttatcgcatcaatggcaggcggaaccgaaatcgaaaccgtcgccgaaacaaat
cctgaagcaattatttatgccggtgtcaatccagccatcggattttctccttatctttct
gcgcgcgttggcggcgcactgcaactggataaatcctatcaattgccgcttacaaaactg
atgaatcgtctttaccaattatttattgataacgatttaacgctactcgaactcaatccg
cttatcatcaccgaagatcacgaatttttaccgcttgacgctaaaatcagcatcgatgat
aacgcgctctttcgtcatcaagaattggtggatttacgcgacacaacgcaggaagatcac
cgcgaaacgcaggctcaagaattgcaattaaattatgttccgctcgacggtaccatcggc
tgcatcgcaaacggcgcaggtcttgccatggcaaccatggacatcattaaactgtacggc
ggtgaaccggcaaactttttagatgttggcggtgatgccacatcagaacgcgttaaacaa
gcctttaaactcattttgacgtcatcgcgcatcaaatccattttggtcaatatttttggc
ggtattgtccgctgcgatttaatcgccgacggcatcattcaagcggcaaaagaaatcgat
ttaaaaattcccgtcatcgtgcgtttacaaggcaataatgttgatctcgggcgcaaaatg
ctcgacgaatgtccgttaaatttgcaagctgcggacgatttaatcgatgcggcgcaaaaa
gccatcgcggcagcacaataa

DBGET integrated database retrieval system