KEGG   Draconibacterium orientale: FH5T_06595Help
Entry
FH5T_06595        CDS       T03072                                 

Definition
glucosylceramidase
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
doi  Draconibacterium orientale
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:doi00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    FH5T_06595
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    FH5T_06595
Enzymes [BR:doi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     FH5T_06595
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
Position
complement(1585568..1587067)
Genome map
AA seq 499 aa AA seqDB search
MRKLFDIKFILLITLLCSGFVACSDDNNGDIEEPVQPEPETGDVTLYITTNTRSHDFATK
AVDFSDKSNMSPTTINLEPETRYQTMDGFGAAITGSTCYNLLQMTEDNREKFLKETFSPT
EGMGYSYVRISIGCSDFSLSEYTCCDTEGIENFGLTSEETDYVIPILQEIQKINPDLKIL
GSPWTCPRWMKVNNLTDLQPFNSWTSGQLNPAYYADYATYFVKWIQVLKEYGIDIYSVTP
QNEPLNRGNSASLFMGWEEQLGFVKNNLVPAFKAASLNTKIYLFDHNYNYDNMGDQNDYP
VKIYDAGIDDELVAGAAYHNYGGNKDELLDIHAKYPERGLIFTETSIGTWNNGRNLETRL
IEDMREVALGTVNNWCKGVIVWNLMLDSERGPNRDGGCQTCYGAVDIDRANYSSITRNSH
YYIIGHLSSVVKPGAVRIGTSGFSDAGFYYSAFENTDGTYAVVLLNSNSASKMITLDDGT
NHFSYEVPGKSVISYQWKK
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgaggaaattattcgatataaaatttattttgctgataacgctgctttgtagtggtttt
gtggcctgtagcgatgataataacggtgacattgaagaacctgtgcaacccgaaccggaa
acaggagatgttacgctttacattacaacgaatacgaggtcgcacgattttgcaacaaaa
gcagttgactttagcgataaaagcaatatgtcgccaactaccattaacctggagccggaa
acgcgctaccagacaatggatggttttggagcggcaattacgggctcaacctgttataac
ctgttacaaatgacagaggataaccgggagaagttcctgaaagaaaccttctctccaaca
gagggaatgggctacagttacgttcgtatttccattggttgttccgacttttcgctcagc
gaatacacctgttgcgataccgagggaatcgaaaacttcggccttacttcggaagaaacc
gattacgtgattccgattttgcaggaaattcagaaaattaatcctgatcttaaaattctg
ggatcgccatggacctgcccacgctggatgaaagtgaataatctaactgatttacaacct
ttcaactcgtggacaagcggtcagttaaatccggcgtattatgccgattatgccacgtat
tttgtaaagtggattcaggttttaaaggaatacggaatcgatatttactcggtaacgccg
caaaacgaaccacttaacagaggtaattcagcgtcgttgtttatgggctgggaagaacaa
cttggttttgtgaaaaacaacctggtgcctgcttttaaagccgcatcattaaacacaaaa
atttatttgttcgaccacaattataactacgataacatgggcgatcagaatgattacccg
gttaaaatttacgatgcaggaattgatgacgaacttgtggccggtgccgcttatcacaat
tacggtggaaacaaggatgaattgctcgatatacatgcaaaataccctgaaagaggattg
attttcactgaaacatctatcggtacatggaacaacggccggaacctggaaacccgctta
attgaagatatgcgcgaggtggcactgggaaccgtaaataactggtgtaaaggagtaatt
gtttggaacctaatgctcgacagcgaaaggggacccaatcgcgacggcggatgtcaaacg
tgttacggtgcagtggatatcgacagagcgaactattcatcgattacacgcaattcgcac
tattacattatcggccacttgtcgtcggtagttaagcctggtgcagtgcgcatcggtact
tcgggtttttctgatgccggattttactactcggcattcgaaaacaccgacggaacttat
gccgtggtattattgaacagtaattcggcttcaaaaatgataacactcgacgatggcacc
aatcacttcagttacgaagtgccgggcaaatctgttatttcataccaatggaaaaaataa

DBGET integrated database retrieval system