KEGG   Draconibacterium orientale: FH5T_11810Help
Entry
FH5T_11810        CDS       T03072                                 

Definition
alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
doi  Draconibacterium orientale
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:doi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    FH5T_11810
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    FH5T_11810
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    FH5T_11810
Enzymes [BR:doi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     FH5T_11810
Exosome [BR:doi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   FH5T_11810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
Position
complement(2812479..2813633)
Genome map
AA seq 384 aa AA seqDB search
MLQKLFLLFAFCALTIGTFGQDAYLNAKSENTDKIYPGNTPYEVKIYPQKFKAKKPKNVI
FLIGDGMGVSQVFSGITANQGHLFLENFRHIGFSKTQSADNYITDSAAGGTALACGVKTY
NGAIGVDADTVKVKSILEEAADKGLATGLIATAAITHATPASFIAHQPSRNMYENIATDF
LNTDIDVFIGGGNDHFTKRKDGRNLVKELEDKGYTYETDINKIAKVKSGKLAGLTAGVHN
GRVAERGDMLPIATSTALNILDNSKKGFFLMIEGSQIDWGGHASSTVYIVEDMLDFDRTI
GKALEFAAKDGETLVVVTADHETGGMALTGGDMSTGMVKADYPTTSHSAVMVPVFAYGPG
AEEFMGIMENTDVHDKMKKLLLSK
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgttacaaaaattatttttattatttgccttttgtgccctcactatcgggacatttggg
caagatgcataccttaatgcaaaatcagaaaatacagacaaaatttacccgggcaacacc
ccttacgaggtaaaaatttatccacaaaagtttaaagcaaagaaacccaaaaacgttatt
ttccttattggcgacggtatgggagtaagccaggttttttccggaattacagcaaaccag
ggacatttatttctcgaaaacttccgccacattggtttttcaaaaacccagtcggccgat
aattatattaccgattcggcagccggcggaacagccctggcctgtggtgtaaagacatac
aacggcgcaattggcgttgatgccgataccgttaaagtaaaatcaatacttgaagaagcc
gctgataaaggattggcgactggactgattgccactgcggcaattacacacgccactcct
gcatcgtttatagcgcatcagcccagccgaaatatgtacgaaaacattgctacagatttc
ctgaacaccgacattgatgtgtttatcggcggtggaaacgatcattttaccaaacgcaaa
gatggacgtaatctggttaaagagcttgaagataaaggttacacttatgaaaccgacatc
aataagatagccaaagtaaaaagtggaaaactggccggtttaactgccggagttcacaac
ggaagagtggcagaacgtggcgatatgctaccgattgcaacatctacagcacttaacatt
cttgacaatagcaaaaaaggattcttcctgatgattgaaggctcgcaaattgattggggt
ggccatgccagcagcacggtttacattgttgaagatatgctcgactttgaccgtacaatt
ggcaaagcccttgagtttgcagccaaagatggtgagacccttgtagtggttactgccgat
cacgaaaccggaggaatggctttaacaggtggcgacatgagcaccggaatggtaaaagcc
gattacccaacaaccagccactcggcggttatggttccggtttttgcatacggaccggga
gctgaggaatttatgggtattatggaaaataccgacgttcacgacaagatgaaaaagttg
cttctcagcaaatag

DBGET integrated database retrieval system