KEGG   Desulfococcus oleovorans: Dole_0200Help
Entry
Dole_0200         CDS       T00610                                 

Definition
(GenBank) cytochrome c class I
Organism
dol  Desulfococcus oleovorans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrome_C7 Cytochrom_c3_2 FixO
Motif
Other DBs
NCBI-ProteinID: ABW66010
JGI: Dole0200
UniProt: A8ZSU7
Position
217765..219996
Genome map
AA seq 743 aa AA seqDB search
MNAKKTIQASFGIRVLFVVVSAALLIVTAWVIMGEKEDLQQWQQHQAAYNDQYAAMLAEK
LAGAKAAEDEEAVKKWAKLKDGHDRSMDIKMRAVFLPDAQVRDLCQSCHMGMENSLFATA
EHPLKAHSPEILADHKITRYGCSLCHHGQGAGLNPEKAHGFEENWEKPRIPLKYIESACF
ECHENVYGLKGAEKAAEGKTAFTEMGCYGCHDANVIEGLPKFSVPFSGMARKISSKKWVY
KWIEDPQATRPGTLMPTFRMEPQELAGIVEYIWSLEDPDLRLPAFNTRSGSAKTGKAVFT
DKGCIACHSPDRNKAGQSRRVPMLSDAGQKLTALWMAKWIEDPRSINPDTWMPKLDITPE
DVKNLAVYLTTVKDGEVGTRLDFDMADGKKEDGKALVQARGCLGCHIVKGAEDPSKVGVS
VADVADKRMEELPFGNSDVPFTKWDWLDNKIRKPDIYKTDDMPMYMPDYVMTDEEREHLV
IFYLYNRLLDLPENYIVRASRQQVVNERGDWMIRHFNCKGCHEILDGEKPRIDTFIAKKS
MVPPRIVNEAEKTQPTWLFNYLRRPSAMRPWLEMRMPEFNFTYDDVPMVIEHLHALMPEK
SRRVSPIPYEPALVQTDYDEETIEMGKYRFRNDKCMQCHPVSFTGELPEGKQLEDLSINL
MISKTRLRFEWIKNFMRDPNTYAGVGTKMPYVFYTPDKVPRIPDPEAWLDRTALFLMFME
EVPEAVQEEEKQREVEEFDFSNY
NT seq 2232 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcaaaaaaaacgattcaggcaagtttcggcatacgggttctgtttgttgttgtg
tccgcggcccttttgattgtcaccgcatgggtcattatgggtgaaaaagaggacttgcag
cagtggcagcagcatcaggcggcctataatgatcagtacgcggccatgctggcggaaaag
ctggccggggcaaaggcggctgaagacgaagaggcggtaaaaaaatgggccaagctcaag
gacggccatgaccggtccatggatatcaagatgcgggccgtgtttttgcccgatgcccag
gtgcgggacctttgccagtcctgccacatgggcatggaaaattcgctgtttgccacggct
gaacatcccttgaaggcccattctccggagattttggcggatcataagatcacccgctac
ggatgctccctctgccatcatggccagggggccgggctgaacccggaaaaggcccacggg
tttgaggagaactgggaaaagccgagaattccgctcaagtatatcgagagcgcctgcttt
gaatgccacgagaacgtgtacgggctcaaaggcgctgaaaaggcggccgaagggaaaacg
gcctttacggaaatgggctgttacgggtgccatgatgccaacgtgattgaaggactgccc
aagttttccgtaccgttttccggtatggccagaaagatttccagtaaaaaatgggtgtac
aagtggatcgaagacccccaggccacgcggcccggaacccttatgcccacgtttcggatg
gagcctcaggaactggccggtattgtggagtatatctggtcgctggaggatccggacctt
cggcttcccgcatttaatacccgcagcggcagcgccaaaacaggcaaagcggtttttacc
gacaaggggtgtatcgcctgccacagcccggaccggaacaaggccggacagtcccgccgg
gtgcccatgctctccgatgcgggccagaagctgaccgccctgtggatggccaagtggatt
gaagacccccggtcgatcaacccggatacatggatgcccaaacttgatattacaccggag
gacgtaaaaaacctcgcggtctatctgaccacggtcaaagacggggaggtgggtacccgg
ctcgactttgacatggcggatgggaaaaaagaggacggcaaggccctggtgcaggcccgc
ggctgcctgggatgccatatcgtgaaaggggccgaggacccttccaaggtgggggtttcc
gtggccgacgtggcggacaagcgcatggaggagctgcccttcggcaattccgatgtccct
ttcaccaagtgggactggctggacaacaagattcgcaagccggacatttacaagactgac
gacatgcccatgtacatgcccgattacgtgatgaccgacgaggagcgggagcacctggtc
atcttttacctgtacaaccgcctgttggatctgccggaaaactatattgtccgggcttcc
cgccagcaggttgtcaacgagcggggcgactggatgattcgccacttcaactgcaaggga
tgccacgagatacttgacggtgaaaaaccgcgcatcgacacgtttatcgccaaaaagtcc
atggtgccgccccgtatcgtcaacgaggcggaaaagacccagcccacatggcttttcaac
tacctgcggcggcccagtgccatgcggccgtggctggagatgcgcatgcccgagttcaat
tttacctatgacgatgttcccatggttatcgaacacctgcacgcgctgatgccggaaaaa
agccggcgcgtgagccccattccttatgagccggccctggtgcagaccgactatgacgag
gaaaccattgaaatgggcaagtaccggttccgaaacgacaagtgtatgcagtgtcatccg
gtctcttttaccggcgagctgcccgagggcaagcagctggaggacctttccatcaacctg
atgatttccaagacccggctgcggtttgaatggatcaagaactttatgcgcgaccccaac
acctatgccggggtgggcaccaagatgccctacgtgttttacacgccggacaaggtcccc
cgcattcccgaccccgaggcgtggctggaccggaccgcgcttttcctgatgtttatggag
gaggtgcccgaggccgtgcaggaggaggaaaaacagcgagaggtcgaggagtttgatttc
agcaattattaa

DBGET integrated database retrieval system