KEGG   Candidatus Desulfococcus oleovorans: Dole_0499Help
Entry
Dole_0499         CDS       T00610                                 

Definition
Triose-phosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
dol  Candidatus Desulfococcus oleovorans
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:dol00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Dole_0499
   01230 Biosynthesis of amino acids
    Dole_0499
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dole_0499
   00051 Fructose and mannose metabolism
    Dole_0499
   00562 Inositol phosphate metabolism
    Dole_0499
Enzymes [BR:dol01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Dole_0499
Exosome [BR:dol04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Dole_0499
  Exosomal proteins of bladder cancer cells
   Dole_0499
  Exosomal proteins of melanoma cells
   Dole_0499
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(567084..567839)
Genome map
AA seq 251 aa AA seqDB search
MTARTPLIAGNWKMHKTGDEAGDTAADLARRIAGVTGREVMIAPPFTALAAVKIAIAGSI
IGLGGQNLHWESSGAFTGEISGPMLTAAGCTHVIIGHSERRQFFGETDETVNKKIQAARA
ANLVPVMCIGETEAQREAEQTFSVLDKQIRNGLQGFALQDISDLVLAYEPVWAIGTGKTA
SREQAQEAHAFIRSVVEKLFGGPAAAAMRILYGGSVKPSNIADLMAMDDIDGALVGGASL
EAATFADIVTY
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgaccgctcgaacaccgctgatcgcgggaaactggaagatgcacaagaccggcgacgag
gccggggatacggccgcggacctggcccggcgcattgccggtgttaccgggcgggaggta
atgatcgccccgccctttacggccctggccgctgtaaaaatcgccattgccggcagtatt
atcggcctgggcggccagaacctccactgggagtccagtggggcctttaccggtgaaatt
tccggccccatgctgacggccgcgggctgcacccatgtgattatcggccattcagaacgc
cgccagtttttcggagaaaccgatgaaacggtgaacaaaaaaattcaggcggcccgggcg
gcaaacctggtgccggtgatgtgcatcggcgagaccgaagcccagagagaagcagagcag
accttttctgtacttgacaaacagattcgaaacgggttacaagggtttgctttacaggat
ataagcgacctggtgcttgcctacgagccggtctgggccatcggcaccggcaaaaccgcg
agtcgggaacaggcccaggaagcccacgcgtttatccgttcggtggtagaaaagctgttc
ggcggcccggcagcggcggccatgcgcatcctgtacggcggcagcgtcaagccgtccaac
atcgcggacctgatggccatggacgacattgacggcgcactggtaggcggcgccagcctg
gaggcggccaccttcgccgacattgtaacgtactaa

DBGET integrated database retrieval system