KEGG   Candidatus Desulfococcus oleovorans: Dole_0514Help
Entry
Dole_0514         CDS       T00610                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase catalytic subunit (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
dol  Candidatus Desulfococcus oleovorans
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:dol00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:dol00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
578968..579903
Genome map
AA seq 311 aa AA seqDB search
MGLSTRDILDMGSLSRKDISLVLDTARSMKEISLRPVKKVPTLRGKTVVSFFYEPSTRTK
VSFDVAAKRLSADSISLSVATSSMTKGETLLDTVKNLERMSPDVVVIRHSSAGVPHMLAR
HVSVPVINAGDGMHAHPSQALLDMMTVQEKKGRIEGLRLAIIGDIARSRVARSNVEGFLK
MGASVVLAAPPTMIPVGVETFGADVTHNVDEAIAGADVIMMLRIQKERAAAFLFSTVREY
ARTYGLTANRLKNAKKDVLIMHPGPVNRGVEIAPEVADGPYSVILDQVENGVAVRMALFY
LVMGGQRDAGD
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atggggctttcaacacgcgatattctggacatggggtcgctgagtcgcaaggacatttcc
ctggttctggacacggcccggagcatgaaggagatatccctgcggccggtaaaaaaggtg
cccacccttcggggaaaaaccgttgtcagttttttctatgagcccagcacccgcaccaag
gtctcttttgacgtggcggccaagcggctttccgctgattcgatttccctttccgtggcc
accagcagcatgaccaagggagagacccttctggacacggtgaaaaacctggagcgcatg
agcccggacgtggtggtgatccgccattcgtcggccggcgttccccacatgctggcccgc
cacgtgtcggtgccggtgatcaacgccggtgacggcatgcacgctcacccctcccaggcc
cttttggacatgatgacggtgcaggagaaaaagggccgcatcgaggggctgcggctggcc
attatcggcgatatcgcccgcagccgggtggcccggtccaacgtggaggggtttttaaag
atgggggccagcgtggtgctggcggcgccgcccaccatgattcccgtgggagtggagacc
tttggcgcggacgtgacccacaacgtggacgaggctattgccggcgccgatgtgatcatg
atgctgcgcattcaaaaggagcgagccgccgcctttctcttttccacggtccgggagtat
gccagaacctacggcctgacggccaatcgattgaagaacgccaaaaaggacgttctgatc
atgcaccccggcccggtaaaccggggcgtggagatcgcgcccgaggtggccgacggcccc
tactccgtgatactggaccaggtggaaaacggggtggcggtgcgcatggccctgttttat
cttgtgatgggaggtcagcgggatgctggtgattaa

DBGET integrated database retrieval system