KEGG   Desulfococcus oleovorans: Dole_0540Help
Entry
Dole_0540         CDS       T00610                                 

Definition
(GenBank) recombination protein RecR
  KO
K06187  recombination protein RecR
Organism
dol  Desulfococcus oleovorans
Pathway
dol03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:dol00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Dole_0540
DNA repair and recombination proteins [BR:dol03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     Dole_0540
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Dole_0540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Toprim_4 RecR Toprim HHH_5 IMS_HHH HHH Toprim_2
Motif
Other DBs
NCBI-ProteinID: ABW66350
JGI: Dole0540
UniProt: A8ZU38
Position
complement(606702..607301)
Genome map
AA seq 199 aa AA seqDB search
MLPYPPSIRNAISHLSRLPGIGQKTAERLAMHLLHVPDRAVHELARSLVDLKKNTRMCSV
CFTLSDTPVCAICGDPDRNASLLCVVEGPTEVMAIEKTAAFKGVYHVLHGVLSPMDGIGP
DDIRIRELVDRVKKGIVKEIVLATDTRVEGEATAAYLVEVLKPFPVTVTRIASGMPAGGE
VRYSDPVTLKNAMEKRYAL
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
gtgcttccctatccgccctccattcgcaacgcgatttcccacctttcccggcttcccggc
atcggccagaaaaccgcggagcggctggccatgcacctgcttcacgtgccggaccgggcc
gtgcacgaactggcccgcagcctggtggacctgaaaaaaaacacccgaatgtgctcggtc
tgttttaccttaagcgacaccccggtgtgcgccatctgcggcgatcccgaccgcaacgcc
tcactgctctgcgtggtggaaggccccaccgaggtgatggccattgaaaaaacggcggcc
ttcaagggcgtgtaccatgtgcttcacggtgtactttctcccatggacggcatcggccct
gatgatattcgcattcgggagctggtggaccgggtaaaaaaaggaattgtcaaagagatc
gtgctcgccaccgatacccgggtggagggagaggccacggccgcctacctggttgaggtg
ttaaaaccctttcctgttaccgtgacccgcatcgcctcgggcatgcccgccggcggagaa
gtccggtacagcgacccggtgacccttaaaaacgccatggaaaaacgctatgccctctga

DBGET integrated database retrieval system