KEGG   Candidatus Desulfococcus oleovorans: Dole_0651Help
Entry
Dole_0651         CDS       T00610                                 

Definition
sucrose phosphorylase (EC:2.4.1.7)
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
dol  Candidatus Desulfococcus oleovorans
Pathway
Starch and sucrose metabolism
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:dol00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
777022..778470
Genome map
AA seq 482 aa AA seqDB search
MTLRNRIQVISYPDSLGKNLQELHYVLRRYFADAAGGVHLLPFYPSSADRGFAPVTYYQV
DPAFGTWRDIELIQEDFDITIDFMVNHISRQSKYVADFIEKGDKSEYADMFLSFNKLAPD
GEIRKEDLDKVYTRKPSPPYQVIERPDGSRETIWSTFDYEQIDVDVQSPVTRELFRDFLI
FLSRRKPEFIRMDAFAYTTIRLGTNCFFVEPEVWELLEMLEGFVSPFGVQLLPEVHEHYS
YQLKLAEKGYWVYDFALPMLVLHTLYHHTNKRLLHWLRICPRRQFTTLDTHDGLGVVDVA
DLMSQEEIERTVDGLYEKGSNIKRIYSTADYQNLDIYQVNCTYYSALERNDDSYLAARTL
QFYAPGIPHVYYVGLLAGENDVALVEATRNGRDINRHNYTLDEIAVAVEREVVQRLIRLM
RFRSSYPAFDGELVIEETPENRVALTWNMPPYTTTARVDLDSYRTEITFWDADTRSEKSF
VV
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgaccctgagaaaccggattcaggttatcagttacccggacagcctgggaaaaaacctt
caggagctgcactacgtgttgcgccgctattttgccgatgccgccggtggcgtgcatctg
cttcccttttacccgtcgtccgcggaccgggggtttgcccccgttacctattaccaggtg
gaccccgccttcggcacctggcgtgacatcgagctgattcaggaggactttgacatcacc
atcgacttcatggtcaaccacatctcccgccagtccaagtacgtggccgacttcattgaa
aagggagataaatccgaatatgccgacatgttcttgagtttcaacaagctggcgcccgac
ggtgaaatccgcaaggaagatctggacaaggtctatacgagaaagccgtcgcctccctat
caggtgattgaacggcccgacggttcacgggagaccatctggtccacgtttgactacgaa
cagatcgacgtggatgtccagtccccggtcacccgggagctgttccgggattttctgatt
tttctttcccgccgaaagccggaatttatccgcatggacgcttttgcctacaccaccatt
cgcctgggcaccaactgcttctttgtcgaaccggaagtgtgggagcttctggaaatgctg
gaggggtttgtctcccccttcggcgtgcagctgctgccagaggtccacgagcactactcc
taccagttgaagctggctgaaaaaggctactgggtctatgactttgccctgcccatgctg
gtgctgcacaccctttatcatcacaccaacaagcggctgctgcactggcttcgcatctgt
ccccgccggcagttcaccaccctggacacccatgacggcctgggcgtggtggacgtggcc
gacctcatgagccaggaggagatcgagcgcaccgtggacggtctgtatgaaaagggttcc
aacatcaagcgcatctattccaccgccgattaccagaacctggacatctaccaggtcaac
tgcacctactattcggcactggagcgcaacgacgactcctacctggcggcccggaccctt
cagttctacgcgccgggcattcctcatgtttactacgtggggctgctggccggggaaaac
gatgtggccctggtggaggccacccggaacggccgggacatcaaccggcacaattacacc
ctggacgaaatcgccgtggcggtggagcgggaggtggtgcagcggctgatccggctgatg
cggtttcgcagcagctatcccgcctttgacggcgagctggtcatcgaagagacaccggaa
aaccgggtggccctcacgtggaacatgcctccctataccaccacggcccgggtggacctg
gacagctaccgcaccgagatcaccttctgggatgccgatacccggtcggaaaagtctttt
gtggtatga

DBGET integrated database retrieval system