KEGG   Candidatus Desulfococcus oleovorans: Dole_0847Help
Entry
Dole_0847         CDS       T00610                                 

Definition
alpha amylase all-beta
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
dol  Candidatus Desulfococcus oleovorans
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dol00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Dole_0847
Enzymes [BR:dol01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Dole_0847
Exosome [BR:dol04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Dole_0847
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(988602..990656)
Genome map
AA seq 684 aa AA seqDB search
MDPTTPAFDKTQTDTVTALVKRLLERDALLTPYAPVLERRLSRVLNLEKTLAGPQGRLAD
IAAEYDYFGLHREQDGWVFREWAPNATAIFLIGETNGWQPSKDFALARIQDNGIWELRLP
GNTLSHGQLFRLLVQWEGGQGDRIPSYARRVVQDPHTLIFNAQVWEAPAYEWRHEPPDLS
SQPALIYEAHVGMAQQEGQVGTFAAFTEKVLPRIIDSGYNTLQLMAIQEHPYYGSFGYHV
SNFFAVSSRFGTPEDLKQLVDTAHGAGLRVIMDIVHSHAVSNEVEGLSRFDGTLHQYFHD
GPRGLHTAWDSRCFDYGKEPVLRFLLSNCRFWLEEYRFDGFRFDGITSMLYLDHGLEKAF
TGYDDYFNHNVDEEALTYLTLANRVIHQVRPDAITIAEDISGMPGLATPIGAGGIGFDFR
LAMGVPDYWVRLVKEYADEAWPMGHLWHELNNRRYDEKSISYAESHDQALVGDQTLMFRM
AGAAMYHHMCVDDPDTTVDRAMALHKMMRFITLTTAGHGYQSFMGNEFGHPEWIDFPRPG
NAWSYHYARRQWHLADDPGLKYHFLQAFDREMVALVRRFSVLDAPWPYLLYEHNDDKILA
FSRAGLVFVFNFHPTRSYTDYAIHAPAGKYIMILNSDDAAFGGHHRLAPDQEHLTLPMPN
TKTAHRLFLYLPTRTALVLKADKA
NT seq 2055 nt NT seq  +upstreamnt  +downstreamnt
atggatcccacaacaccggccttcgacaaaacacagaccgacacagtgaccgctcttgta
aagcggctgctggaaagggacgcgctgctgacgccctatgccccggttctcgaacggcgg
ctgagccgcgtgctgaatcttgaaaaaaccctggccggtccccagggccggctggccgac
atcgccgcggaatatgactatttcgggctgcaccgggagcaggacggctgggtgttccgg
gagtgggcccccaatgccacggccatttttcttatcggcgagaccaacggctggcagccc
tcaaaggattttgccctggcccgcattcaggacaacggcatatgggaactgcggctgccc
ggcaacaccctttcccacgggcagcttttccggctccttgtccagtgggaaggcggccag
ggagaccgcattccctcttatgcccgccgggtggtccaggatccccacaccctgatcttc
aacgcccaggtgtgggaagcgccggcctatgaatggcgccacgaaccaccggatctcagt
tcccagccggcactgatctatgaagcccacgtgggcatggcccagcaggagggccaggtg
ggcacctttgccgcgtttaccgaaaaggtgctgccccggatcatcgactcgggctacaac
acgttgcagctcatggccattcaggagcacccctattacggctcctttggctaccatgtc
tcaaactttttcgcggtctcgtcccgttttggtacgcctgaagacctcaagcaactggtg
gacacggcccacggcgccggcctgcgggtgatcatggacatcgtccactcccacgcggtc
tccaacgaggtggaggggctgagccggtttgacggcaccctgcaccagtattttcacgac
ggcccccgggggcttcacacggcctgggactcccgctgctttgattacggcaaggagccg
gtgctgcggttcctgctgtccaattgccgcttctggctggaggaataccggtttgacggg
ttccggtttgacggcatcaccagcatgctctacctggaccatgggctggaaaaagccttt
accgggtatgacgactattttaaccacaacgtggacgaggaggccctgacctacctgacc
ctggccaaccgggtcatccaccaggtccggcccgacgcgatcaccattgccgaagacatc
agcggcatgccggggctggccacgcccattggggccgggggcatcggttttgattttcgc
ctggccatgggggtaccggactactgggtccggctggtcaaggaatacgccgacgaggcc
tggcccatgggccacctgtggcacgaactcaacaaccggcgctatgacgaaaaatcgatc
agttatgccgagtcccacgaccaggccctggtgggggaccagaccctcatgttccgcatg
gccggggccgccatgtaccatcacatgtgcgtggatgatcccgacaccactgtggaccgg
gccatggcccttcacaagatgatgcggtttatcaccctgaccacggccggccacggctac
cagagctttatgggcaacgagttcggccatcccgaatggatcgattttccccggccggga
aacgcctggtcctatcactacgcccggcgccagtggcacctggccgatgaccccggcctg
aaataccacttcttacaggcctttgaccgggagatggttgccctggtcaggcgcttttcc
gtgctcgacgccccctggccctacctgctctacgaacacaacgacgacaagattctcgcc
ttttcccgggccgggctggtgtttgtgttcaactttcaccccacccggtcctacaccgac
tatgccattcacgcgcccgccggcaaatacatcatgattctaaacagcgatgacgcggcc
tttggcggccaccaccgcctggcaccggaccaggaacacctcacccttcccatgcccaac
accaaaacggcccaccggctctttctctaccttcccacccgcaccgccctggtgctgaaa
gcggataaggcgtaa

DBGET integrated database retrieval system