KEGG   Candidatus Desulfococcus oleovorans: Dole_0860Help
Entry
Dole_0860         CDS       T00610                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
dol  Candidatus Desulfococcus oleovorans
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:dol00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Dole_0860
   01230 Biosynthesis of amino acids
    Dole_0860
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dole_0860
   00030 Pentose phosphate pathway
    Dole_0860
   00051 Fructose and mannose metabolism
    Dole_0860
   00052 Galactose metabolism
    Dole_0860
  Energy metabolism
   00680 Methane metabolism
    Dole_0860
Enzymes [BR:dol01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Dole_0860
Protein phosphatases and associated proteins [BR:dol01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Dole_0860
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1009312..1010409
Genome map
AA seq 365 aa AA seqDB search
MRIAINTGGGDAPGLNAVIEAVVMSAWYRNWEVYGIRQGYHGLLDTDDIIQLTPDKVRNI
SSVGGTILGTTNKGNPFEMPFENGAGEVEIRDVSDRVVRNFQRLGFDCLIAVGGDGSLKI
AHDFFKKGIPVIGVPKTIDNDMVGTVATFGFDTAVSIATEAIDRLHSTAKSHDRVMVVEV
MGRHAGWIALNSGVSGGARAILIPEIPFDIDVVCEQIMNDELQGTRYAIVVAAEGAKPLG
GEIVHRGDGEKGRQDVLLGGIGNVVAEAINKKTGKDTRSLVLGHLQRGGSPTTFDRLLAL
RFGAAAVRLVEAKQFGRMVALNPPNIDAVLLEDVVGAIRTVPLESDTLQTARDIGISFGE
PASDQ
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgcgcattgccatcaacaccggcggcggggacgcgccgggactgaacgcggtgattgag
gcggtggtgatgtcggcctggtaccgcaactgggaggtgtatggcattcgccagggctac
cacggcctgctggacacagacgatatcattcaactgacgccggacaaggtgagaaacatt
tccagtgtgggcggcaccatcctgggtaccaccaacaagggcaacccctttgagatgccc
tttgaaaacggcgccggtgaggtggaaattcgcgacgtgtccgaccgggtggtgcgcaat
tttcagcggctggggtttgactgcctcatcgccgtgggcggggacggcagcctgaaaatc
gcccatgattttttcaaaaaaggcattcccgtgatcggcgtgcccaagaccattgacaat
gacatggtcggcacggtggccacctttggttttgacacggcggtgagtatcgccacagag
gccattgaccggctgcactccacggccaagtcccacgaccgggtcatggtggtggaggtc
atgggccgccatgccgggtggattgccttaaacagtggcgtttccggcggggccagagcc
attttaattccggagatcccgtttgacatcgacgtggtgtgtgaacagatcatgaatgat
gagcttcagggcacccggtatgccatcgtggtggcggccgagggggccaaacccctgggc
ggggagatcgtgcaccggggcgatggcgaaaaaggccgccaggacgtgctgctgggcggc
atcggcaatgtcgtggccgaggccatcaacaaaaaaaccggcaaggacacccggtccctg
gtgctgggccatcttcagcgggggggctcccccaccacctttgaccggctgctggccctg
cggttcggcgcggccgccgtccggctggtggaggcaaaacagttcggccgcatggtggcc
cttaacccgcccaacatcgacgcggttcttctggaagatgttgtgggtgctattcgaacg
gtccccctggagagcgacacccttcagaccgcccgggacatcggcatctctttcggcgaa
ccggcatcggaccaatag

DBGET integrated database retrieval system