KEGG   Candidatus Desulfococcus oleovorans: Dole_0988Help
Entry
Dole_0988         CDS       T00610                                 

Definition
response regulator receiver modulated CheB methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
dol  Candidatus Desulfococcus oleovorans
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:dol00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Dole_0988
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Dole_0988
Enzymes [BR:dol01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Dole_0988
Two-component system [BR:dol02022]
 CheA family
  CheA-CheYBV
   Dole_0988
Bacterial motility proteins [BR:dol02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Dole_0988
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1158610..1159764)
Genome map
AA seq 384 aa AA seqDB search
MKEPMDDTEKLKVLVVDDTILYRKIVSDALAELPNIEIVGTANNGKTALSRILTLHPDLI
TLDVEMPSMDGIEVLEEIARQQIDVGVIMLSSLTYEGGELTVKALQLGAFDFIPKPELSS
ISDNRQYIRDRLAAIIRSFTGRREIKRILSGKTVFRRATPGLPSAAAARPIITAETVAHR
LQKADKQVRRAGGSKVVAIGISTGGPRALGTLIPMLPADINVPILVVQHMPPLFTQSLAK
SLNAKSSLFVKEAEEGDELIPNTVFIAPGGRHMKLTSGAGRKIIAVTDDPPENSCRPSAD
YLFRSVAEHFGEAATGVIMTGMGTDGNRGLETMKQRNSFIIAQDEATCTVFGMPRWPIEA
EIVDVVAPLDRVAQAIINSVRPSR
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaaccgatggacgataccgaaaaactgaaggtgctggttgttgacgacaccatc
ctgtacagaaaaattgtaagtgatgctctggccgagttgcccaacattgagatcgtggga
acggccaacaacggcaaaaccgccctctcccgcattcttaccctgcatcccgacttgatc
acgctggacgtggaaatgcccagcatggacggcattgaggtgctcgaagagatcgcccgc
cagcaaatcgacgtgggcgtgatcatgctcagttccctcacctacgaagggggtgaactg
accgtcaaggccctgcagctgggagcctttgactttattcccaagccggagctgagttcc
atcagtgacaaccggcaatatattcgggaccggctggccgccattatccggtctttcacg
ggccgaagagagatcaaacgcattctttccggaaaaaccgtgttccgccgggcgacgccg
ggactaccgtccgcggcagcggctcgccccatcatcaccgccgaaaccgtggcccatcgc
cttcagaaagccgacaaacaggtccggcgcgccggcggctccaaggtggtggccatcggc
atttccacaggcgggccccgggccctgggcaccctgattcccatgctgccggcggacatt
aatgtgccgattcttgtggttcagcacatgccgccccttttcacccagtccctggccaaa
agcctcaacgccaaatcttctctttttgtaaaggaggcggaagagggcgacgagctgatc
cccaacaccgtgttcatcgccccggggggccgacacatgaaactgacctccggcgcgggc
aggaagatcatcgccgtcaccgacgacccgccggaaaacagctgccggccctcggcggat
tacctcttccggtccgtagccgagcacttcggcgaggccgccaccggcgtaatcatgacc
ggtatgggaacggacggcaaccgcggcctggaaacaatgaaacagcgcaacagctttatc
atcgcccaggacgaggctacctgcaccgtctttggcatgcccagatggcccattgaagcc
gaaatcgtggatgtggtggcgcccctagaccgtgtggcccaggcaattatcaactccgtc
agaccctccagatag

DBGET integrated database retrieval system