KEGG   Candidatus Desulfococcus oleovorans: Dole_1056Help
Entry
Dole_1056         CDS       T00610                                 

Definition
exodeoxyribonuclease V subunit alpha (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
dol  Candidatus Desulfococcus oleovorans
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:dol00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Dole_1056
Enzymes [BR:dol01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Dole_1056
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1249047..1250876
Genome map
AA seq 609 aa AA seqDB search
MDGYRDIQAAMPMLGELDRRFGELLTALDPGGGKELFLAAALTLWHTRRGHVCFDLNRAD
AFLTDGLDGVSLPDGRQWADILSRSAVVARPGGDPAPLVLDGEGRLYLHRYWAYQEQLAD
FIRSRAGIIRKVDAHRLKEGLTRWFPGQGPGNGPDMQRVAAVSALTHDFSVITGGPGTGK
TLTAARILALLAEQAENRPLAAVLTAPTGKAAARLGEAMSTLRGAVPGPASENRLEVRAC
TIHRLLGALPGTTVFRHHRHNPIAADVVVVDEASMADVALMAKMVDALPDHCRLILVGDK
DQLASVAAGSVFADICGAAGRNRFSADFLQALEAAGVLTGGMKAFPAGTARLAGNVVHLE
TVYRFEHRGGMEMVSRLVREGAAGEIVEALATPGHQDVTWTAPDQEEWRERLARTVTAWV
KDCLSVSANPEMVLDRLGSFRVLCALREGPAGALALNRSVEHSLQRAGVVASGRLWYAGR
PVMVLKNDYSLELFNGDVGITLWDGDRLSVFFKDDRGGVRKFHPGRIPEHETVYAMTVHK
GQGSEFEKVVFVMPDRDGPVLTRELVYTALTRARSHIEIIGKKDIIEAAVSRSVSRRSGL
VEAINNDQD
NT seq 1830 nt NT seq  +upstreamnt  +downstreamnt
gtggacggatatcgggatattcaggcggcaatgccgatgctcggtgaactggatcgccgg
ttcggcgaactcctgacggcccttgatcccggcggcgggaaagagctgtttctggccgct
gcccttaccctctggcacacgcgcagggggcatgtctgttttgatcttaatcgggcagac
gcctttctgacggacggccttgacggcgtttcccttcccgacggccgccagtgggctgac
atcctgtcccgaagcgcggtggtggcccggcccggcggcgacccggcccctcttgttctg
gacggagaaggacggctgtacctgcaccggtactgggcctatcaggagcaactggccgat
tttatccgttcccgggccggtattattcgaaaggtggacgcacaccggttgaaggagggc
cttacccggtggtttcccggccaggggcccggcaacggcccggacatgcagcgtgtggcg
gccgtatcggcactgacccatgatttttctgtgatcaccggcggcccgggtacgggaaag
acccttaccgcggcacgaattctggccctgctggcagaacaggccgagaaccggcccctg
gcagccgttttgaccgcgcccacgggaaaggccgcggcccgcctgggtgaggcgatgtct
acgctgcgcggagccgtcccgggtccggcatctgaaaaccggctggaggtccgggcctgt
accattcatcgcctgctgggagcccttccgggaacaacggttttccggcatcatcgtcac
aaccccattgccgccgacgtggtggtggtggacgaagcctccatggcggatgtcgccctc
atggcaaagatggtggatgccttgcccgatcactgccggctgatactggtgggggacaaa
gaccagcttgcctcggtggcggcagggtcggtgtttgccgatatctgcggcgcggcgggg
agaaaccggttttccgctgattttcttcaggcccttgaagcagccggggtgctgaccgga
gggatgaaggcctttcctgcgggcaccgcccgcctggccggcaacgtggtgcaccttgaa
acggtttatcgctttgaacaccggggcggcatggaaatggtgagccggctggtgcgggaa
ggggcggccggtgaaattgtggaagccctggcgacccccggccatcaggatgtcacatgg
acagctccggaccaggaagagtggcgggaacgactggcacggaccgtgacggcctgggta
aaagactgcctgtcggtgtcggcgaatccggaaatggtgcttgaccggctggggtcgttt
cgcgtactgtgcgctttgcgcgaagggcctgccggcgccctggcccttaaccggtctgtc
gaacactctcttcaacgggcaggggttgtggcttcaggccggctgtggtatgcgggtcgt
ccggtaatggtgctgaaaaacgactattccctggagttgtttaacggcgatgtcggtatc
actttgtgggacggcgatcggctgagcgtctttttcaaagacgaccggggcggggtgaga
aaatttcatcccggccgcattcccgaacatgaaaccgtttatgccatgacggttcacaag
ggccagggctcggagtttgaaaaggtggtgtttgtgatgccggacagggacggcccggtg
ttgacccgtgagcttgtgtacacggccctgacccgtgccagatcccatattgaaattatc
gggaaaaaggatattattgaggcggccgtgtcccgatcggtttcaagacggtccggcctt
gtggaggcaatcaataacgaccaggactaa

DBGET integrated database retrieval system