KEGG   Desulfococcus oleovorans: Dole_1175Help
Entry
Dole_1175         CDS       T00610                                 

Definition
(GenBank) Phosphomannomutase
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
dol  Desulfococcus oleovorans
Pathway
dol00010  Glycolysis / Gluconeogenesis
dol00030  Pentose phosphate pathway
dol00051  Fructose and mannose metabolism
dol00052  Galactose metabolism
dol00230  Purine metabolism
dol00500  Starch and sucrose metabolism
dol00520  Amino sugar and nucleotide sugar metabolism
dol00521  Streptomycin biosynthesis
dol01100  Metabolic pathways
dol01110  Biosynthesis of secondary metabolites
dol01120  Microbial metabolism in diverse environments
dol01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:dol00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dole_1175
   00030 Pentose phosphate pathway
    Dole_1175
   00051 Fructose and mannose metabolism
    Dole_1175
   00052 Galactose metabolism
    Dole_1175
   00500 Starch and sucrose metabolism
    Dole_1175
   00520 Amino sugar and nucleotide sugar metabolism
    Dole_1175
  Nucleotide metabolism
   00230 Purine metabolism
    Dole_1175
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Dole_1175
Enzymes [BR:dol01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     Dole_1175
    5.4.2.8  phosphomannomutase
     Dole_1175
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_III PGM_PMM_II PGM_PMM_IV DUF2218
Motif
Other DBs
NCBI-ProteinID: ABW66981
JGI: Dole1175
UniProt: A8ZXM3
Position
1403654..1404997
Genome map
AA seq 447 aa AA seqDB search
MDAKIFREYDIRGVAGTDLTEADVLLIGKAAGTYLRNHGKSFAAVGRDCRLTSPSYAEKI
IEGLRSTGCDVLDLGICPTPVFYFAIHHFKTGGGVMITASHNPPEYNGFKLCIDLDSIHG
KDILKLKKIIDSGDFVSGSGSLESADPVAPYRQYVESNISISRKLKVGVDAGNGTAGVVA
VPVLKALGCEVHDIYCDMDGTFPNHEADPTVLKNMADLITMVREKKLDVGIGYDGDGDRI
GVVDENGNIVYGDKLIILFAREILSRKPGAVFVSEVKCSKVMYDDIEKHGGRAIMWKTGH
SLIKAKMKEEKAALAGEMSGHIFFADRYLGYDDAIYSSCRLLELIADAGNPISSLLSDIP
KTFTTPEIRVECPDDKKFDLVKRVTEHFRKTHKVVDIDGVRVLFDDGWGLVRASNTQPAL
VMRFEAMSEDRLAEIQKLVEDAVDLFK
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atggacgcaaaaattttcagggaatatgacattcgcggcgtagccggcactgatcttact
gaagccgacgtgctgctgatcggcaaggccgccggcacctacctgcggaaccacggcaag
tcttttgccgccgtgggccgggactgccgcctgacctcaccctcctacgcggagaaaatc
attgagggacttcggtccaccgggtgcgatgtgctggatctgggcatttgtcccacaccg
gtgttctattttgccattcaccattttaaaaccgggggcggggtcatgataacggccagc
cacaacccgcccgagtacaacgggttcaagctctgcatcgatctggattccattcacggc
aaggacattttaaaactcaagaagatcattgactcaggggattttgtctccgggtccggt
tccctggagtccgccgatccggtggcgccctaccgtcaatacgtggagtccaacatctct
atttcgcggaagctcaaggtgggggtggacgccggcaacggcacggccggcgtggtggcg
gtgccggttctcaaggccctgggctgcgaggtccatgacatttactgcgatatggacggc
acctttcccaaccacgaggccgaccccacggtgctcaagaacatggctgatctcatcacc
atggtgcgcgagaaaaaactggacgtgggcatcgggtatgacggcgacggggacagaatc
ggcgtggtggatgaaaacggtaacattgtatacggcgacaagctgatcattctgtttgcc
cgggagatcctctcccgcaaacccggcgcggtctttgtgtccgaggtcaagtgttccaag
gtgatgtacgacgacattgagaagcacgggggccgggccatcatgtggaaaaccggccac
tccctgatcaaggccaagatgaaggaagaaaaagcggccctggccggggagatgagcggc
catatcttttttgccgaccggtacctgggctatgacgacgccatctattcctcctgtcgt
ctgctggagctgatcgccgacgcgggcaacccgatctcctccctgctgtccgacattccc
aaaacatttaccaccccggaaatccgcgtggagtgcccggacgacaagaagtttgacctg
gtaaaaagggtcaccgagcattttcgaaagacccacaaggtggtggacatcgacggtgtg
cgggtgctctttgacgacggttgggggctggtgcgggcctccaacacccagccggccctg
gtgatgcgatttgaagccatgtccgaagaccggttggccgagattcaaaaactggtggaa
gacgcggtggatctctttaaatag

DBGET integrated database retrieval system