KEGG   Candidatus Desulfococcus oleovorans: Dole_1224Help
Entry
Dole_1224         CDS       T00610                                 

Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
dol  Candidatus Desulfococcus oleovorans
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dol00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Dole_1224
Enzymes [BR:dol01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Dole_1224
Exosome [BR:dol04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Dole_1224
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1461785..1462756)
Genome map
AA seq 323 aa AA seqDB search
MLFPDYRPRRMRQNENLRRMIRETRLSTDNLILPLFAVPGKGVREPIDAMPGQYRLSTDN
LVAVAKEAAGLGIPAIMLFGVPGKKDPLGTGAYAKDGIVQQAVKAVKNAVPGLVVITDVC
LCQYTDHGHCGVLENGVVDNDGTLDLLARTAVSHAKAGADMVAPSDMMDGRVAEIREALD
ENDLAHVPIMSYAVKYCSAYYGPFRQAANSAPKAGDRKTYQMDPANAIEAIREASMDIEE
GADIIMVKPALPYLDIIRSLRDEIDLPIAAYNVSGEYAMIKAGAQMGWVDGEKVMMETLL
SIKRAGADMILTYFAMDAARLIS
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgctttttcccgactaccgcccccggcggatgcggcagaatgaaaatctccggcgcatg
atccgggagacccggctttccaccgacaacctgatccttcccctgtttgccgtacccggc
aagggggtcagggagcccattgacgccatgcccggtcagtaccggctttccacggacaac
ctggtggccgtggcaaaagaggccgccggcctgggcattcccgccatcatgctctttggc
gtgcccggcaaaaaagaccccctgggcaccggggcctacgcaaaggacggtattgttcag
caggcggtcaaagcggtgaaaaacgcggtgcccggcctggtggtgatcaccgatgtctgc
ctgtgccagtacacagaccacggccactgcggcgttctggaaaacggcgtggtggacaac
gacggcaccctggacctgctggcccgtaccgccgtctcccatgccaaggccggggccgac
atggtggccccgtcggacatgatggacggccgggtggcggagatccgggaggccctggac
gaaaacgaccttgcccatgtgcccatcatgtcttacgcggtcaagtactgctcggcctac
tacggccccttccgccaggccgcgaactcggcccccaaggccggggaccggaaaacctac
cagatggacccggccaacgccattgaagccattcgggaagccagcatggacatcgaggag
ggcgcggacatcatcatggtcaagccggccctgccctacctggacattattcgcagcctg
cgcgatgagatcgacctgcccatcgccgcctacaacgtcagcggcgaatacgccatgatc
aaggccggggcccagatgggatgggtggacggcgaaaaagtgatgatggaaaccctgctc
tccatcaagcgggccggggccgatatgatcctgacctactttgccatggacgcggcccgc
ctgatctcataa

DBGET integrated database retrieval system