KEGG   Candidatus Desulfococcus oleovorans: Dole_1248Help
Entry
Dole_1248         CDS       T00610                                 

Definition
alpha amylase catalytic subunit
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
dol  Candidatus Desulfococcus oleovorans
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:dol00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Dole_1248
Enzymes [BR:dol01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.7  sucrose phosphorylase
     Dole_1248
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1491426..1493132
Genome map
AA seq 568 aa AA seqDB search
MNTVDNQIQSLLERIYDPDTAGQAAGHLNRLMAGFPARPAQKQSFFSEADTVLITYGNTL
NRPGQAPLGTLGEFARTRLKDAFSAVHVLPFFPYSSDDGFSVIDFYRVDPDLGTWDDIAA
LCRDFDLMVDLVLNHISAQSPWFSRYLAKEQGFEDLAIEARPGEDLMCVVRPRTTPLLTP
FKKADGTTVHVWTTFSVDQVDLNYCSVGVLEKMVDVLLFYVGQGAAFIRLDAVAYLWKKP
GTYCIHLEQTHDMVRLFRAVLDRVAPDTVLVTETNVPHAENISYFGHGGDEAQVVYNFTL
PPLLLHAFITENTAALTRWAATLELPSDRTTFLNFTASHDGIGVRPLEGILPEAEIDRLT
AHTLENGGQVSFRTRPDGSQAPYELNITYLDALSRAGDSDTTRAARLLASLAVQLALPGI
PAVYIHTLLGTRNWADGVKQTGRARTINRRPLDTDDVNRAIDTAGTLGHAVFHAALYLLN
LRRRQPAFHPNAPFAVLDLSSRVFAIRRTCAEQTLVAVTSVSGASQTIALPPDTPAQMTD
LVTGRPMNTGDLHLEPWQTVWLADAAPL
NT seq 1707 nt NT seq  +upstreamnt  +downstreamnt
ttgaacaccgttgacaaccagatccagtcgctgctggaaagaatctacgacccggacacg
gccggccaggccgctggccatctgaaccgcctgatggccggctttcccgcacggcccgca
caaaaacagtcctttttttccgaggccgacacggtcctcatcacctacggcaacaccttg
aaccggccgggccaggccccgctgggaactttgggcgaatttgcccgcacccggctgaag
gatgccttttccgcggttcacgtgctgccctttttcccctattcatcggatgacgggttt
tccgtgatcgatttttaccgggtggaccccgatctgggtacctgggacgacatcgccgcc
ctgtgcagggattttgacctgatggtggacctggtgctcaaccacatctcagcccagagc
ccctggttttcccgttaccttgccaaagagcaggggtttgaagacctggccattgaggcc
cggcccggagaagacctgatgtgcgtggtgcggccccgcaccacccctctgctgaccccc
tttaaaaaggcggacggtacaaccgttcatgtgtggaccaccttttccgtcgaccaggtg
gacttgaactactgcagcgtgggcgtgctggaaaagatggtggatgtgctgctgttctac
gtggggcagggggccgccttcatccggctggacgcggtggcctatctctggaaaaagccc
ggcacttactgcattcacctggaacagacccacgacatggtccggctgtttcgggccgtg
ctggaccgggtggccccggacacggtgctggtcaccgagaccaacgtgccccacgccgaa
aacatcagctatttcggccatggcggggacgaggcccaggtggtgtacaattttacactg
ccgcccctgctgcttcatgcctttattacggagaacaccgcagccctgacccggtgggcc
gccaccctggaactgccgtcggaccgcaccacttttttaaactttaccgcctcccacgac
ggtatcggggtccggcccctggagggcattcttcccgaggccgaaatcgaccggctgacg
gcccataccctggaaaacgggggccaggtctcttttcgcacccggccggacggctcccag
gccccttatgagctcaacatcacctacctggacgccctgagccgggccggcgacagcgat
accacccgtgccgcccgcctgctggcctccctggccgtgcaactggcactgcccggcata
ccggcggtctacattcacaccctgctgggtacgcgcaactgggccgatggggtcaaacag
accggccgggcccgcaccatcaatcgccggcctctggacacagacgatgtaaaccgggcc
attgatacagccggcactcttggccacgcggtttttcacgcggccctttacctactgaac
ctgcgccggcgccagcccgcgttccaccccaacgcgccttttgccgtgctggacctctct
tcccgtgtttttgccattcgccggacctgcgccgaacagaccctggtcgccgtcaccagt
gtgtcgggtgcttcccagaccattgcattgccgccggacaccccggcccaaatgaccgac
ctggtgaccggccggcccatgaacaccggcgatcttcacctggaaccctggcagacggta
tggctggccgatgcggcccctttataa

DBGET integrated database retrieval system