KEGG   Candidatus Desulfococcus oleovorans: Dole_1395Help
Entry
Dole_1395         CDS       T00610                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
dol  Candidatus Desulfococcus oleovorans
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dol00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Dole_1395
Enzymes [BR:dol01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Dole_1395
Exosome [BR:dol04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Dole_1395
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1657003..1658520)
Genome map
AA seq 505 aa AA seqDB search
MTDKQYVGAIDQGTTSTRFVVFDTTGAMVASHQVEHRQIYPEPGFVEHDPMEIRANTAGI
IAEALKKGLIEPDQIAAVGITNQRETTVVWNRHTGRPLYNAIVWQDTRTADMCTALKQEG
HEPLFKEKTGLPAASYFSGPKIRWILDNVEGARAAAEKGDALFGNMDTWLIWWLTGGPGK
GVHVTDVTNASRTMLMNLETLAWDSELLKILDIPEKMLPRIMASSEVYGHAAQNWGLAPG
TPVSGDLGDQQAALFGQVCFEPGEAKNTYGTGCFLLSNTGQKIIHSNHGLLTTLGYKIGN
EPPVYALEGSVAVAGSLVQWLRDNLNLIRTSPEVEDLAKTVADNGGVYFVPAFSGLFAPH
WDSSARGLIIGMTHYINKGHIARAALESTAFQVNEIFSAMEKDSGIPFKSLKVDGGMAAN
DLLMQFQADLVRVPVIRSAVLESTVLGAAYAAGLAVGFWSKKEDLRRHWKENGQWQPEMA
AALRDKMCAQWDKAIKRAAGWKEEG
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgaccgataaacagtacgtgggcgccattgaccagggcaccaccagcacccgtttcgtg
gtgtttgacacaaccggcgccatggtggccagccaccaggtggaacaccggcagatttac
ccggaaccggggttcgtggagcatgaccccatggagattcgggccaacacagccggcatc
attgccgaagccctgaaaaaagggctgattgaaccggaccagatcgctgccgtgggcatc
accaaccagcgggaaaccacggtggtgtggaaccggcacaccggcaggcccctttataac
gccatagtgtggcaggacacccgcaccgcggacatgtgcaccgcgctaaaacaggagggc
cacgaaccgctgtttaaggaaaaaaccgggctgccggcagcctcctatttttccggcccc
aagatcaggtggattcttgataatgtggaaggggcccgggcagcggccgaaaaaggggat
gccctgttcggcaacatggacacctggctgatctggtggctcaccggcgggccgggcaag
ggggtgcatgtcacggacgtgaccaatgccagccgcaccatgctgatgaaccttgaaacc
ctggcctgggacagcgagcttttaaagatcctcgacattccggaaaagatgctgccccgc
atcatggcctccagcgaggtttacggccatgccgcccaaaactggggcctagcaccgggc
accccggtttccggggacctgggggaccagcaggcggccctgttcggccaggtctgcttt
gagccgggggaagccaaaaacacatacggcaccggctgttttctgctgtccaacaccggc
cagaaaattattcactcaaaccacggcctgctgaccaccctgggctacaaaattgggaac
gagcccccggtctacgcccttgagggatcagtggccgttgccgggtccctggtgcagtgg
ctgcgggacaacctgaacctgatccgcacctcccccgaggttgaagacctggccaaaacc
gttgccgacaacggcggcgtctattttgtgccggccttttccggcctgtttgccccacac
tgggacagctcagcccggggcctgatcatcggcatgacccactacatcaacaaaggccac
atcgcccgggcggccctggagtccacggcctttcaggtcaacgagattttcagcgccatg
gaaaaggattccggcattcccttcaaatccctgaaggtggatggcggcatggcggccaac
gacctgctgatgcagttccaggccgacctggtgcgcgttccggtgatccggtccgcggtc
ctggaatccacagtgctgggcgcggcctatgccgccggcctggccgttggcttctggagc
aaaaaggaggacctgcgacgccactggaaggaaaacggccaatggcagccggaaatggcg
gccgcccttcgggataaaatgtgcgcccagtgggacaaggcgataaaacgggccgccggc
tggaaggaggaaggatga

DBGET integrated database retrieval system