KEGG   Candidatus Desulfococcus oleovorans: Dole_1563Help
Entry
Dole_1563         CDS       T00610                                 

Definition
(GenBank) tryptophan synthase, alpha subunit (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
dol  Candidatus Desulfococcus oleovorans
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:dol00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Dole_1563
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Dole_1563
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Dole_1563
Enzymes [BR:dol01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Dole_1563
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(1861786..1862583)
Genome map
AA seq 265 aa AA seqDB search
MNRITETFDRLAAKKEKALVGFVTAGDPAIETSEAIIRAMCEAGIDILELGVPFSDPTAD
GPVIQRSSQRALANGTNLQTVFDMTATLRKTFQGPIILFSYYNPIFRYGAENFYRDAKQA
GADGVLVVDLPPEESAELTSCWKGDDFALIRLLAPTTPDGRIGAIAASASGFLYLVSMTG
VTGSSGLDTTHIADLCAKVQRHTALPICVGFGVSTADDVAKIAQHADGVVIGSAFERLIE
ESIGKPDIAGILAERTREYKAATKM
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgtattactgaaacatttgaccgcctggccgcaaaaaaagaaaaggcccttgtg
gggtttgtcaccgccggagaccctgccattgaaacctccgaggccattatcagggccatg
tgcgaagccggtatcgatatcctggagctgggcgtacccttttcagaccccacggccgac
gggccggtgatccagcgctcttcccagcgggcccttgccaatggaacgaacctgcaaacc
gtttttgatatgacggccaccttgcgcaaaacattccagggtccgatcatcctgttttcc
tattacaaccccatcttccggtatggagcggaaaacttttaccgtgacgcgaaacaggcc
ggggctgacggggtcctggtggtggacctgccgcccgaagagtcggcggaactcacttcc
tgctggaagggcgacgattttgccctgatccggctgctggccccaaccacgccggacggg
cgcatcggggccatagcggcgtcggcttccgggtttctctaccttgtttccatgaccggg
gtcacgggcagcagcgggctggacaccacccacatcgccgacctgtgcgcaaaagtccaa
cgtcacaccgcgcttcccatctgtgtgggctttggcgtgagcaccgccgatgacgtggct
aaaatcgcgcaacatgccgacggcgtggtcatcggcagcgcctttgaacggctgatcgaa
gagagcatcggcaaacccgatatcgcgggaatccttgccgagcgaacacgggaatacaaa
gcagcgacaaagatgtga

DBGET integrated database retrieval system