KEGG   Desulfococcus oleovorans: Dole_1771Help
Entry
Dole_1771         CDS       T00610                                 

Definition
(GenBank) Aldehyde ferredoxin oxidoreductase
  KO
K03738  aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
dol  Desulfococcus oleovorans
Pathway
dol00030  Pentose phosphate pathway
dol01100  Metabolic pathways
dol01120  Microbial metabolism in diverse environments
dol01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:dol00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Dole_1771
Enzymes [BR:dol01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     Dole_1771
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AFOR_C AFOR_N
Motif
Other DBs
NCBI-ProteinID: ABW67575
JGI: Dole1771
UniProt: A9A0V0
Position
complement(2133707..2135572)
Genome map
AA seq 621 aa AA seqDB search
MKKEMTGTSNRILEIDLSSGKSTVFKVPESLRTLYLGGKGLGLKLIFDRMNLNADPLGPE
NILAFMPGVLMGTGAPCTGRFAAVTKSPQTGIMATASCGGAFGMQLKTAGWDGLLVTGTA
QAPVYLMITADGAEIRDAGDLWGLETTACQQRLAADKNTGVLAIGPAGENRVRFANIASG
HRFLGRGGMGAVMGAKNLKAVVAKGGDFKILPVDPALFEKTKQKAARYIKGNAMTSATYT
TFGTRANVTPSNRANILPINNFFDGQDDRAVNLSGEVINKAHHTSHSTCKPCSILCGQKG
EFGGEVLPVPEFETVGLLGSNIGIFDTNRIAEFNRVCGEMGMDTISAGGTLAWVMEAAEK
GMVESPLRFGAAEGVSQALLDIAHCRGFGAEMAEGVRVLSEKYGGKEFAMHVKGMEMAAY
DPRGSVGQGLAYAVANRGACHLSAYMIAQEIYFKLLDPYRTRAKPEFVKFFESITCCVNS
LHTCQFTMFAYLLEPPSAKYSPDLVLGFFMQNVPEIAIRLIDFSVYTRLWSAVTGIPMSN
GAFLAAGDRIHVLERYMNTRMGISRKDDTLPGRLLMEGRASDPRKRVVPLDKMLSKYYKL
RGFDDNGIPTEKTLKRLGIAA
NT seq 1866 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagagatgacaggcacctccaaccgtatcctggagattgacctttccagcggc
aaaagtactgttttcaaggttccggaatcgctccgcaccctgtacctgggcggcaagggg
ctggggttgaaactgatttttgaccgtatgaacctgaacgccgacccgctgggcccggaa
aacatacttgctttcatgcccggggtgcttatgggtaccggcgcgccgtgcaccggacgt
tttgccgctgtgaccaagtcaccccagaccggcatcatggcgaccgcctcctgcggcggg
gctttcggcatgcagttgaaaaccgccgggtgggacggcctgctggtcaccggaacggcc
caggccccggtttacctgatgattacggccgacggggccgagattcgggatgcaggggac
ctgtgggggctggagaccacggcctgccagcagcgccttgccgcagacaaaaacaccggc
gtgctggccatcggcccggccggggaaaaccgggtgcggtttgccaacatcgcgtcgggc
caccggttcctgggccggggcggtatgggcgccgtgatgggcgcaaaaaacctcaaggcc
gtggtggcaaaggggggcgactttaaaattctaccggtcgatccggcactgtttgaaaag
acgaaacagaaagcggcccgatacatcaaaggcaacgccatgacctcggccacctacacc
accttcggcacccgggccaacgtgacgcccagcaacagggccaatatcctgcccatcaac
aactttttcgacggccaggacgaccgggccgtcaatctttccggagaggtgatcaacaag
gcccatcacacctcccacagcacctgcaagccctgttccattctgtgcggccagaaaggg
gagttcggcggagaggtactgccggtaccggagtttgagaccgtgggcctgctgggctcc
aacatcggcatttttgacaccaaccgcattgccgagttcaaccgtgtctgcggagagatg
ggcatggacaccatttccgccggcggcacgcttgcatgggtgatggaggccgcggaaaaa
ggcatggtggaaagccccctgcggtttggcgcggccgaaggcgtgtcccaggccctgctg
gatatcgcccactgccgggggttcggcgccgagatggcggaaggcgtacgggttttgtct
gaaaaatacgggggaaaagagtttgccatgcatgtcaagggcatggagatggccgcctat
gaccccaggggatcggtgggccagggcctggcctatgccgtggccaatcgtggcgcctgt
cacctgtcggcttacatgatcgcccaggagatctatttcaagctgctcgacccttaccgg
acccgggccaaacccgagttcgtcaaatttttcgaaagcatcacctgctgcgtcaattcg
ctgcacacctgccagttcaccatgttcgcctacctgctggaaccgccgtcggcaaagtat
tcgccggatctggtgctgggcttcttcatgcagaacgttccggagatcgccattcggctg
attgatttttccgtctacacccgcctgtggagcgcggtcaccggcattcccatgtccaac
ggcgcgtttttagcggccggagaccggattcatgtgctggagcgctacatgaacacccga
atgggcatctcccgcaaggacgacaccctgcccggccgcctgctcatggagggccgggct
tcggatccccgcaagcgggtggtgccccttgataaaatgctgagcaagtattataagctc
cgtgggtttgacgacaatggcattcccactgaaaagacattaaagcgtctcggcattgcc
gcatga

DBGET integrated database retrieval system