KEGG   Desulfococcus oleovorans: Dole_1973Help
Entry
Dole_1973         CDS       T00610                                 

Definition
(GenBank) AMP-dependent synthetase and ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
dol  Desulfococcus oleovorans
Pathway
dol00010  Glycolysis / Gluconeogenesis
dol00620  Pyruvate metabolism
dol00640  Propanoate metabolism
dol00680  Methane metabolism
dol01100  Metabolic pathways
dol01110  Biosynthesis of secondary metabolites
dol01120  Microbial metabolism in diverse environments
dol01130  Biosynthesis of antibiotics
dol01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:dol00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dole_1973
   00620 Pyruvate metabolism
    Dole_1973
   00640 Propanoate metabolism
    Dole_1973
  Energy metabolism
   00680 Methane metabolism
    Dole_1973
Enzymes [BR:dol01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Dole_1973
Lipid biosynthesis proteins [BR:dol01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Dole_1973
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: ABW67777
JGI: Dole1973
UniProt: A8ZT94
Position
complement(2385796..2387526)
Genome map
AA seq 576 aa AA seqDB search
MIKARIPAHNSHANLSGYVAARRSFKWSNAAAELGINSDAGVNIIAQSIDKWAARPDTAG
QPAMIFHKGGHTDIYTFLQMRDISARWAGFFVKNGLEAGDCLMIFLPPCRAFFFAMAACA
RAGIVFCPVFASSGYSELESRLADIAPKAVLTDPGLVEMIPPERAAALKTLFLTTDAPGL
YDNEIVVGDGPASLPADFSPRLVTPGTALYVVYTSGSTRPPKGIIHGHGDMVGIYASAKW
VLDLKADDVLWTDADPAWVTGTVYAALAPWLCGVASVVSEAPAPSSAVNAYRTLEACRVT
VWYTTPNTIRGLMEAGEDLPGRYNLDALRHIVTVGAPLMPDPFYWVRKHLGLSPHDNWWM
SETGMICIANLPCLDIKPGAIGKPLPGIEAAVLDDSGWELPALSIGQLALKSGWPAMMVG
LWGDRARYEGHFQNNWFLTGDIALQDEEGYFYHQGRLDDILKTRENRAIGPFEIEQALCG
HPAVAEAAVIARGGDRDTGTSSIKAFVTLKPGNPASSRLNREIRMFLKAGVAPDIDVDEI
TFTEKLPRTRNGKLLRRVLRAWELGLPGGDAVSMED
NT seq 1731 nt NT seq  +upstreamnt  +downstreamnt
atgatcaaggcccggatacccgcccataattcccacgccaacctttccggctacgtggcc
gcgcgccggtcgttcaagtggtcgaatgcggctgccgaactgggcatcaacagcgatgcc
ggggtcaacatcatcgcgcaatccatcgataaatgggccgcccggccggacacggccgga
cagccggccatgatatttcacaagggcggtcacaccgatatctacacctttttgcagatg
cgcgacatctcggcccggtgggccggtttttttgtcaaaaacggtcttgaggccggcgac
tgcctgatgatttttctgccgccctgccgggcgttcttttttgccatggccgcctgcgca
agggcaggcattgtgttctgcccggtgtttgcctcttccggttacagtgaactggagtcc
cggctggccgatatcgcgcccaaagctgtcctgaccgaccccggcctggtggagatgatt
ccaccggaaagggccgcagcattgaaaaccctttttctcaccacagacgctcccgggctg
tatgacaatgaaattgttgtgggagacgggcccgcgtccctgcctgccgacttttcaccg
cgcctggtgaccccgggaaccgccctttatgtcgtttacacctccggctccacccggccg
cccaagggtatcattcacggccatggcgatatggtcggcatctacgcctccgcgaaatgg
gtactggacctgaaggccgatgacgtgctgtggaccgatgccgacccggcctgggtcacc
ggaacggtttacgcggccctggccccctggctttgtggcgtggcctctgtggtttcagaa
gcccctgccccttcttccgccgtcaatgcgtaccgcacccttgaggcctgccgggtgacg
gtgtggtacaccacgcccaataccatccgtggcctgatggaggccggcgaggacctgccc
ggccgttacaacctggacgccctgcgccatatcgtcaccgtgggtgccccgttaatgccc
gatcctttttactgggtccgaaaacacctgggcctttctcctcatgacaactggtggatg
tctgaaaccggcatgatctgcatcgccaatctgccctgcctggacattaagcccggcgcc
atcggcaaacccctgcccggcatcgaagccgccgtcctggacgacagcggctgggaactg
ccggccctctccatcggacagctggccctcaagtccgggtggccggccatgatggtcggg
ttgtggggtgaccgggcccggtatgagggtcatttccaaaacaactggtttctcaccggc
gatattgcccttcaggacgaagagggctatttctatcaccagggacggctggacgatatt
ctgaaaaccagggaaaaccgggccatcgggccctttgaaatcgaacaggccctgtgcggt
cacccggccgtggccgaagccgcagtcattgccaggggaggggaccgggacaccggcacc
tcttcgatcaaggcttttgtcaccctgaagcctggcaatccggcttcctcccggctcaat
cgggagatccgcatgtttctcaaggccggcgtggccccggacattgacgtggatgaaatc
acctttactgaaaaactgccccgcacccgcaacggtaaactcctgcgccgtgtcctgcgc
gcctgggaactggggctgcccggcggggatgcagtcagtatggaagattga

DBGET integrated database retrieval system