KEGG   Candidatus Desulfococcus oleovorans: Dole_2111Help
Entry
Dole_2111         CDS       T00610                                 

Definition
diphosphate--fructose-6-phosphate 1-phosphotransferase (EC:2.7.1.90)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
dol  Candidatus Desulfococcus oleovorans
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Brite
KEGG Orthology (KO) [BR:dol00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Dole_2111
   01230 Biosynthesis of amino acids
    Dole_2111
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dole_2111
   00030 Pentose phosphate pathway
    Dole_2111
   00051 Fructose and mannose metabolism
    Dole_2111
   00052 Galactose metabolism
    Dole_2111
  Energy metabolism
   00680 Methane metabolism
    Dole_2111
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Dole_2111
Enzymes [BR:dol01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Dole_2111
Protein phosphatases and associated proteins [BR:dol01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Dole_2111
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2563963..2565297
Genome map
AA seq 444 aa AA seqDB search
MNFDFTNEETLIEQLGEPRVTSPILREPNIDPEKDFTDDTARVLVNVNPDIIQARIQQGK
TPLSFEMAGPRKKIFFDASKVRCALVTCGGLCPGLNDIIRAIVLELYYRYGVKSIHGIRY
GLEGFIPDCGHEVVDLTPELVANILNTGGSMLGSSRGPQDISQIVDSLERMHVGILFMIG
GDGTLMAATKIAEEIGRRNLKISVVGIPKTIDNDIHLISRSFGFDTAVDIATEAIKGAHN
EAEGYPNGIGLIKLMGRHSGFIAATATLARQDVNFVLIPEIDFDLEGDHGLLAALEQRLK
RRKHAVIVVAEGAGQKFFGDGTNATDASGNIRLNDIGLFLRERITAHFKSRGIPISLKYI
DPSYMIRSLPANANDSVFCGFLGRDAVHAAMAGKTRMLVSHWNNHFVHVPMSLTVGKRKQ
VSPHSKLWWTVLEATGQGRFTNSG
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgaattttgattttaccaatgaagagaccctgattgaacagctgggcgagcccagagta
acctctcccattcttcgggagcccaacattgacccggaaaaggactttaccgacgacacg
gcccgggtcctggtcaatgtcaatcccgatattattcaggcccgtatccaacaggggaaa
acgccgttatcctttgagatggccgggccgcgaaaaaagatatttttcgatgccagcaag
gtgcggtgcgccctggttacctgcggtgggctgtgccccggcttaaacgacatcattcgg
gccatcgtgctggaactctactaccggtacggcgtaaaaagcattcacggcatccgctac
ggcctggaaggattcattccggactgcggccacgaggtggtggatctcaccccggaactg
gtggccaatattctcaacaccggtggttcgatgctgggctcctcccgggggccccaggac
atctcacagatcgtggattccctggagcgaatgcacgtgggcattcttttcatgatcggc
ggcgacggcaccctgatggcggcaacaaaaatcgctgaagagatcggccggcgcaacctg
aagatcagcgtggtgggcattcccaagaccattgacaatgacattcacctgatctcccgt
tccttcggttttgacacggccgtggacatcgccaccgaagccatcaagggggcccacaac
gaagctgagggctatcccaacggcatcggcctgatcaaactcatgggccgccactcgggc
tttattgccgccaccgccaccttggcccgccaggatgtcaacttcgtactgattccagag
atcgactttgacctggaaggggatcacggccttctggccgccctggaacagcggctcaag
cggcgaaagcacgccgtcatcgtggtggccgagggggccggtcagaaatttttcggcgac
ggcaccaatgccacggatgcctccggcaacattcggctcaacgacatcgggctttttctg
cgggaacggatcacggcccacttcaagtcccgcggcatccccatctccttaaaatacatc
gatcccagctacatgatccgcagcctgccggccaacgccaacgacagtgtattctgcggt
tttctgggccgggacgcggttcacgcggccatggccggcaaaacccgtatgctggtgagc
cactggaacaaccattttgttcatgtgcccatgtcccttaccgtgggcaaacgcaagcag
gtcagccctcacagcaagctctggtggaccgttctggaggccacgggacagggccgtttt
acaaacagcggataa

DBGET integrated database retrieval system