KEGG   Candidatus Desulfococcus oleovorans: Dole_2111Help
Entry
Dole_2111         CDS       T00610                                 

Definition
diphosphate--fructose-6-phosphate 1-phosphotransferase (EC:2.7.1.90)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
dol  Candidatus Desulfococcus oleovorans
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Class
Metabolism; Overview; Carbon metabolism [PATH:dol01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:dol01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:dol00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:dol00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:dol00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:dol00052]
Metabolism; Energy metabolism; Methane metabolism [PATH:dol00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2563963..2565297
Genome map
AA seq 444 aa AA seqDB search
MNFDFTNEETLIEQLGEPRVTSPILREPNIDPEKDFTDDTARVLVNVNPDIIQARIQQGK
TPLSFEMAGPRKKIFFDASKVRCALVTCGGLCPGLNDIIRAIVLELYYRYGVKSIHGIRY
GLEGFIPDCGHEVVDLTPELVANILNTGGSMLGSSRGPQDISQIVDSLERMHVGILFMIG
GDGTLMAATKIAEEIGRRNLKISVVGIPKTIDNDIHLISRSFGFDTAVDIATEAIKGAHN
EAEGYPNGIGLIKLMGRHSGFIAATATLARQDVNFVLIPEIDFDLEGDHGLLAALEQRLK
RRKHAVIVVAEGAGQKFFGDGTNATDASGNIRLNDIGLFLRERITAHFKSRGIPISLKYI
DPSYMIRSLPANANDSVFCGFLGRDAVHAAMAGKTRMLVSHWNNHFVHVPMSLTVGKRKQ
VSPHSKLWWTVLEATGQGRFTNSG
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgaattttgattttaccaatgaagagaccctgattgaacagctgggcgagcccagagta
acctctcccattcttcgggagcccaacattgacccggaaaaggactttaccgacgacacg
gcccgggtcctggtcaatgtcaatcccgatattattcaggcccgtatccaacaggggaaa
acgccgttatcctttgagatggccgggccgcgaaaaaagatatttttcgatgccagcaag
gtgcggtgcgccctggttacctgcggtgggctgtgccccggcttaaacgacatcattcgg
gccatcgtgctggaactctactaccggtacggcgtaaaaagcattcacggcatccgctac
ggcctggaaggattcattccggactgcggccacgaggtggtggatctcaccccggaactg
gtggccaatattctcaacaccggtggttcgatgctgggctcctcccgggggccccaggac
atctcacagatcgtggattccctggagcgaatgcacgtgggcattcttttcatgatcggc
ggcgacggcaccctgatggcggcaacaaaaatcgctgaagagatcggccggcgcaacctg
aagatcagcgtggtgggcattcccaagaccattgacaatgacattcacctgatctcccgt
tccttcggttttgacacggccgtggacatcgccaccgaagccatcaagggggcccacaac
gaagctgagggctatcccaacggcatcggcctgatcaaactcatgggccgccactcgggc
tttattgccgccaccgccaccttggcccgccaggatgtcaacttcgtactgattccagag
atcgactttgacctggaaggggatcacggccttctggccgccctggaacagcggctcaag
cggcgaaagcacgccgtcatcgtggtggccgagggggccggtcagaaatttttcggcgac
ggcaccaatgccacggatgcctccggcaacattcggctcaacgacatcgggctttttctg
cgggaacggatcacggcccacttcaagtcccgcggcatccccatctccttaaaatacatc
gatcccagctacatgatccgcagcctgccggccaacgccaacgacagtgtattctgcggt
tttctgggccgggacgcggttcacgcggccatggccggcaaaacccgtatgctggtgagc
cactggaacaaccattttgttcatgtgcccatgtcccttaccgtgggcaaacgcaagcag
gtcagccctcacagcaagctctggtggaccgttctggaggccacgggacagggccgtttt
acaaacagcggataa

DBGET integrated database retrieval system