KEGG   Candidatus Desulfococcus oleovorans: Dole_2290Help
Entry
Dole_2290         CDS       T00610                                 

Definition
(RefSeq) iron-containing alcohol dehydrogenase
  KO
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
dol  Candidatus Desulfococcus oleovorans
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:dol00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Dole_2290
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dole_2290
  Lipid metabolism
   00071 Fatty acid degradation
    Dole_2290
  Amino acid metabolism
   00350 Tyrosine metabolism
    Dole_2290
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Dole_2290
   00626 Naphthalene degradation
    Dole_2290
Enzymes [BR:dol01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Dole_2290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2776794..2777978)
Genome map
AA seq 394 aa AA seqDB search
MIPKYFEYFNSVKVVAGKQALARLPEELLNLGVKKPILVTDKGVVNAGLVKVVEENVAGS
GVSIGAVYDETPVDSSIHAVNAIAAIYREKGCDSIIAVGGGSAIDTAKGVNIVLSENTDD
LMKFTGNNRVRAVMKPFVVIPTTGGTGSEVTMAAVIANPDLGVKMQFTTPLMLPDFTILD
PRMTKTMPPKITAATGMDAMTHAVETFMSIQRNPVSDAFAWSAIELLVANLPKAVTDGDD
EDVRLAVATGAMLAGIAFSNSMVGVVHAVAHALGGVCHLPHGIANAIILPFGMEFNLPKA
RDVLSDMLLVLAGPEVFAATPKKQRAEKSIATVRDLIKTLNRTSGLPVCLEQAGVPRNKL
EKVARIAVSDGAANFNPIEIEYQDALNILNRAYA
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgattcccaagtatttcgagtatttcaactccgttaaggtcgtggccggaaagcaggcc
ctggcccggctgcccgaggaactgctgaacctgggtgtcaagaagccgattctggtcact
gataaaggggtggtcaatgccggcctggtcaaggtggtggaagagaacgtggccgggtcc
ggggtctccatcggcgccgtttacgacgaaacaccggtggactcctccattcacgcggtc
aatgccattgccgccatttatcgggaaaaggggtgcgattccatcattgcggtgggcggc
ggctcggccattgacacggccaagggtgtcaacatcgtgctgtcggaaaacaccgacgac
ctgatgaagttcacgggcaacaaccgggtccgggccgtgatgaaaccgtttgtggtgatt
cccaccaccggcggcaccggctctgaagtgaccatggccgcggtgatcgccaacccggat
ctgggggtaaaaatgcagttcaccacgcccctgatgctgccggacttcacgattctggat
ccgcgcatgacaaagaccatgccccccaaaatcacggcggccacgggcatggacgccatg
acccacgccgtggaaaccttcatgagcattcagcgcaacccggtgagtgatgcctttgcc
tggtccgccattgaactgctcgtggcaaatctgcccaaagccgtgaccgacggggacgat
gaagatgtgcggctggccgttgccaccggggccatgctggccggtattgccttttccaac
tccatggtgggagtggttcatgccgtggcccatgccctgggcggtgtatgccaccttccc
cacggcattgccaatgccattattctgccttttggcatggagttcaacctgcccaaggcc
cgggatgttctgtccgacatgctgctggtgctggccggcccagaggtgtttgcggcaaca
ccgaagaaacagcgggccgaaaagtccatcgccaccgtgcgggacctgatcaagaccctg
aaccggaccagcggcctgcccgtctgcctggaacaggccggtgtgcccagaaacaaactg
gaaaaggtggcccgaatagcggtaagcgacggggccgccaatttcaatcccattgagatt
gaataccaggacgcgttgaatatccttaatcgggcctatgcctga

DBGET integrated database retrieval system