KEGG   Candidatus Desulfococcus oleovorans: Dole_2348Help
Entry
Dole_2348         CDS       T00610                                 

Definition
RecD/TraA family helicase (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
dol  Candidatus Desulfococcus oleovorans
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:dol03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2830942..2833110)
Genome map
AA seq 722 aa AA seqDB search
METTLTGQLERITYTSEESGFTVARVRVRGQQDPVTVVGPLLGVSPGEVLEMQGQWTTHP
SFGDQFKVESYKARAPVTVEGIQKYLASGMIKGIGPVTAERITKKFGKKTLQVLETDISR
LAKVPGIGKKRITMIQASWEAHKEVRDVMVFLQSQGIGSGYAMRIFQTYGTGTMDVVTNN
PYRLAADVAGIGFLIADRIAEKLGFAKNSPVRVRAGVLHVLSSLGDDGHVYYPFEPLVRK
SMEILGVDRALVVAAVADEATEKNIVVEELKDDDGEDGKGVYLAGYFLCETGIARRIKEQ
VATGKVIREIDTARAVDWVQKKLSITLAEKQAEAVRTAAKSKLMVITGGPGTGKTTIVKS
VLHIINALGAVVLLAAPTGRAAKKLKEATGHEARTIHRLLEFSMAKGGFQRHDSRPLECD
LLVIDEASMIDTVLMYHLLKAVPPHAVLILVGDVNQLPSVGPGNVLNDIISSGVAPVVTL
NEIFRQARQSRIVVNAHLINQGQLPHIQNDDTAGDFFFVDQEDPDTVADTIVDLVTRRIP
AKFDLDPFDDIQVLTPMHKGTVGAINLNNRLQKALNPESKGIVRGEATFGLSDKVMQIRN
NYDKEVFNGDIGRIVRINQEARVLGVLFDGREVAYDFSELDELVLAYAISVHKSQGSEYP
AVVMPVLTQHYILLQRNLVYTAVTRGRRLVVMVGTKKALAISVNNNRPNLRYTRLRQRLA
GA
NT seq 2169 nt NT seq  +upstreamnt  +downstreamnt
atggaaaccacattgacaggccagctggagcgcatcacctacaccagcgaggagagcggg
tttaccgtggcccgggtcagggtgcggggccaacaagacccggttaccgtggtggggccg
ttgctgggggtgtcaccgggtgaggtccttgaaatgcagggccagtggaccacccacccc
tcctttggtgaccagttcaaggtggaatcttacaaagcccgggccccggtcacggtggag
ggcattcagaaataccttgcctcaggcatgatcaagggcatcggcccggtcacggccgag
cgcatcacaaaaaagttcggtaaaaagacccttcaggtcctggagaccgacatcagccgc
ctggccaaagtgccgggcatcggcaagaaacgcatcaccatgattcaggcgtcctgggag
gcccacaaagaagtccgggacgtgatggtctttttgcagagccagggcatcggctccggc
tacgccatgcgcatttttcagacgtatggcaccggcaccatggacgtggtgacgaacaac
ccctaccggctggccgctgacgtggccggcatcgggtttctcatcgccgaccgcatcgct
gaaaaactggggtttgccaaaaattcaccggtgcgggtgcgggcaggggtgctgcatgtg
ctttccagcctgggcgatgacggccatgtctattacccctttgagccgctggtccgaaag
agcatggagatcctgggcgtggaccgggcactggtggtggctgccgttgccgacgaggca
acggaaaaaaatatcgtggtcgaggagttgaaggatgacgacggcgaggacggcaagggg
gtttacctggccggctattttctgtgcgaaaccggcatcgcccgccggataaaagagcag
gtggccaccggcaaggtgattcgggagatcgacacggccagggccgtggactgggtgcag
aaaaagctttccatcaccctggccgagaagcaggccgaggcggtgcgcaccgcggccaaa
agcaagctcatggtgatcaccggcgggccgggtacgggcaagaccaccatcgtaaagtcc
gtgctgcacatcatcaacgccctgggggccgtggtgctgctggccgcgcccacgggccgg
gccgccaagaaactcaaggaggccaccggccacgaggcccgcaccattcaccgcctgctg
gagttttccatggccaagggcgggttccagcgccacgacagccggcccctggagtgcgat
cttttggtgatcgacgaggcctccatgatcgacacggtgctgatgtaccacctgctcaag
gcggtgccgccccatgccgtgctgatccttgtgggggacgtgaaccagttgccgtcggtg
gggccgggcaacgtgttaaacgatattatctcctcgggcgtggcgccggtggtgacgtta
aacgagattttccgccaggccaggcagagccggatcgtggtcaacgcccatctgatcaac
cagggacaactgccccatattcagaacgacgatacagccggcgactttttctttgtggac
caggaagacccggacacggttgccgacaccattgtcgacctggtcacccgccgcattccg
gcaaagtttgaccttgatccctttgacgacattcaggtgctgacccccatgcacaaggga
acggtgggcgccatcaacctgaataaccggctgcagaaggcgttaaacccggagtcaaag
ggcattgtccggggcgaggccaccttcggcctgtcggacaaggtgatgcagattcgcaac
aactatgacaaggaagtgttcaacggcgacatcggccgcattgtccgtatcaatcaggag
gcccgggtgctgggcgttctgtttgacgggcgggaggtggcttacgatttttcagagtta
gacgagctggtgctggcctatgccatttccgtgcacaagtcccagggatcggagtatccg
gcggtggtgatgcctgttctgacccagcactacatcctgttgcagcgcaacctggtgtac
acggccgtgacccggggccgccgcctggtggtgatggtgggcaccaaaaaggccctggcc
atcagcgtgaacaacaaccggcccaacctgcgctacacgcggctgcgccagcggctggcc
ggtgcataa

DBGET integrated database retrieval system