KEGG   Desulfococcus oleovorans: Dole_2555Help
Entry
Dole_2555         CDS       T00610                                 

Definition
(GenBank) Enoyl-CoA hydratase/isomerase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
dol  Desulfococcus oleovorans
Pathway
dol00071  Fatty acid degradation
dol00280  Valine, leucine and isoleucine degradation
dol00281  Geraniol degradation
dol00310  Lysine degradation
dol00360  Phenylalanine metabolism
dol00362  Benzoate degradation
dol00380  Tryptophan metabolism
dol00410  beta-Alanine metabolism
dol00627  Aminobenzoate degradation
dol00640  Propanoate metabolism
dol00650  Butanoate metabolism
dol00903  Limonene and pinene degradation
dol01100  Metabolic pathways
dol01110  Biosynthesis of secondary metabolites
dol01120  Microbial metabolism in diverse environments
dol01130  Biosynthesis of antibiotics
dol01212  Fatty acid metabolism
Module
dol_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:dol00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Dole_2555
   00650 Butanoate metabolism
    Dole_2555
  Lipid metabolism
   00071 Fatty acid degradation
    Dole_2555
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Dole_2555
   00310 Lysine degradation
    Dole_2555
   00360 Phenylalanine metabolism
    Dole_2555
   00380 Tryptophan metabolism
    Dole_2555
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Dole_2555
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Dole_2555
   00281 Geraniol degradation
    Dole_2555
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Dole_2555
   00627 Aminobenzoate degradation
    Dole_2555
   00930 Caprolactam degradation
    Dole_2555
Enzymes [BR:dol01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Dole_2555
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: ABW68359
JGI: Dole2555
UniProt: A8ZWM8
Position
3090932..3091678
Genome map
AA seq 248 aa AA seqDB search
MPIEMDTRDGVMILAMDNAPENAFNSEMIAQFNAALDDIKADDAISGVVVTGAGGQFFSS
GMDLSYVMGLEAGAIKEFFKELFTFFHRAFVFPKPMVAAVNGHAVASALAFSMCLDYRVM
QNQKAVCTFPEIDVSIMPPSGCLAMVKYVIGERMTDLAFLSGRKFDGPAALAVGMVDELA
EGRAVIDRAVAVAGELGEKKPRLFAAYKKRFRGETADCMLAEDLRYIDEEMDVTMFQNCD
LSCLRSLS
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgccgatcgaaatggataccagagacggggtcatgattctggccatggacaatgcgccg
gaaaacgcctttaacagcgagatgatcgcccagttcaacgcggctttagacgacatcaag
gccgacgacgccatttccggcgtggtggtgaccggggccgggggccagttcttttcctcc
ggcatggacctttcctatgtgatggggctggaggcgggcgccatcaaggaatttttcaaa
gagctgtttaccttcttccaccgtgcctttgtgtttcccaagccgatggtggcggcggtc
aacggccatgccgtggccagcgcccttgccttttccatgtgcctggactaccgggtgatg
caaaaccagaaagcagtatgcacctttccggagattgatgtctccattatgccgccctcc
gggtgcctggccatggtgaaatacgtgatcggcgagcgcatgaccgacctggcctttctc
tccggccgcaagtttgacgggccggcggccctggccgtgggcatggtggatgaactggcc
gaaggcagagccgtcatcgaccgggccgtggccgtggcgggcgagctgggcgaaaaaaag
ccccgcctgtttgccgcctacaaaaagcggttccgcggtgaaaccgcggactgcatgctg
gccgaagacctgcggtatatcgacgaagagatggacgtgaccatgttccagaactgcgac
ctctcctgcctgcggtcgttgagttga

DBGET integrated database retrieval system