KEGG   Candidatus Desulfococcus oleovorans: Dole_2746Help
Entry
Dole_2746         CDS       T00610                                 

Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
dol  Candidatus Desulfococcus oleovorans
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:dol00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Dole_2746
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Dole_2746
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Dole_2746
Enzymes [BR:dol01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Dole_2746
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3314110..3315615
Genome map
AA seq 501 aa AA seqDB search
MNPSDFPCDVQPHLVPRPGGDMVYKCLGCDATHDINTLLYTCPSCNSVLLIEDRDFDRHR
AIPGPLWRKIFDFRKSLNIPALKGVYRFHEFIGPDLPLEAVVWLGEGGTPVVEASPLLQQ
KVGIRLFFKNDGQNPSASFKDRGMASAFSRINFLLQSGILSNVLAVCASTGDTSASAALY
AAYLKPRVTSAVLLPHGKVTPQQLSQPLGNGAAVFEIAGVFDDCMKVVEELSENYNVALL
NSKNAWRILGQESYSYEIAQDFSYDTRNLTVVVPIGNAGNITAVMNGFLKFFRIGIINAL
PKIIGVQSDHASPVFQYYREPDPARRRFAPVTVKPSVAQAAMIGNPVSMPRVIRLADRYD
QAAGQRRVFVVEVSEQQIMDWQLTANRHGNIVCTHGGESLAGLVTARQQGLVTDDDMAVL
DSTAHMLKFSNFQQMYFENAFPAHYGVTPDPALVNAPQLVEVPGIATPADRETLSGPEMT
TFVRKTADEIANRLGLKRTKQ
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgaacccttccgactttccatgcgatgtacagccccacctggtgccccggcccgggggc
gacatggtgtataaatgccttgggtgcgacgccacccacgacatcaacacccttctatac
acctgcccttcctgcaacagcgtgctgctgatcgaggaccgggactttgaccggcacagg
gccatccccggccccctgtggcgaaagattttcgattttcgaaaaagcctcaacatcccc
gctttaaaaggggtctaccggtttcacgagtttatcggcccggacctgcccctggaagcg
gtggtatggctgggtgaaggcggtaccccggtggttgaagccagcccgctccttcagcag
aaggtgggaatccgcctctttttcaaaaacgacggccagaatcccagcgcctctttcaag
gaccggggcatggccagcgccttttcccgtattaattttcttttgcaaagcggcatcctc
tccaacgtgctggctgtgtgcgcctccacaggggacacgtcggcatcggcggccctctat
gccgcctatctcaagccccgggtcacatccgccgttcttcttcctcacggcaaggtcaca
ccccagcagctttcccagcccctgggcaacggggccgccgtgtttgaaattgccggcgtg
tttgacgactgcatgaaggtggtcgaagaattgtccgaaaactacaacgtggccctgctc
aactccaaaaatgcctggcgcattctgggtcaggagtcctactcttatgaaatcgcccag
gatttttcctacgacacccggaatctgaccgttgtggtgcccatcggcaatgccggcaac
atcacggcggtgatgaacggcttcttaaaatttttccgaatcggcattatcaatgccctg
cccaaaatcatcggggtccagtccgaccacgccagcccggtgttccagtactacagagag
cccgacccggcccggcgccggtttgccccggtgacggtcaaacccagcgtggcacaggcc
gccatgatcggcaacccggtctccatgccgcgggtgatccgtctggccgaccggtatgac
caggccgccggccaacggcgggtgttcgtggtggaagtatctgagcagcagatcatggac
tggcagctgacggccaaccggcacggcaacatcgtctgcacccatggcggcgaaagcctg
gccggcctggtaacggcacggcagcagggcctggtaaccgacgacgacatggcggtcctg
gactccacggcccacatgctcaagttctccaattttcaacagatgtactttgaaaacgct
tttccggcccattacggggtgacgccggacccggcccttgtcaatgccccgcagctggtt
gaggttcccggcattgccacgccggcggaccgggagacactgagcgggccggagatgaca
acatttgtcagaaaaaccgctgatgagattgcaaaccggcttggcttgaaaaggacaaaa
caatga

DBGET integrated database retrieval system