KEGG   Candidatus Desulfococcus oleovorans: Dole_2792Help
Entry
Dole_2792         CDS       T00610                                 

Definition
UDP-N-acetylmuramyl-tripeptide synthetase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
dol  Candidatus Desulfococcus oleovorans
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:dol00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:dol00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3368209..3369798)
Genome map
AA seq 529 aa AA seqDB search
MRLSELLLPVCPESVRSTAAARGVMPDPEIASIHYRSDEVRPGGLFVAIRGSARDGHDFI
DQALARGAVAVVAEKEVDARDAVTVRVADARNALALLSAVFYGAPSARLVLVGVTGTNGK
TTTAALVEHILVKAGKQVGVIGTGNFRYVGRRFKNPLTTPESADLQHILRDMATAGVTHV
VMEVSSHALAQQRVAGCAFDVAIFTNLTQDHLDFHGDMETYWECKKRLFTGTRSVGVREK
HMVSVINCNDARGRGLFDTLPVPGRMGAGFAEACDIYPKGVTSSPDGLAGTIVTPAGPIP
FCSPLAGTYNLENILCAAGAGVVLGVEGAAIQEGIETFAGVPGRLEKVADRMGRFVFVDY
AHTPDALQNVLSALRKISAGRLFCVFGCGGDRDRAKRPKMGGIAATIADRVVVTSDNPRS
EDPEAIIADIVKGMTGLAERVADVAGLAGKSSNGRYLVEPDRRLAIRAAVSAAAPGDTIL
IAGKGEENYQIFRDRTIDFDDRQEAAAALQARGNSGNDQMPAMSAGQCG
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgagactctccgaactgctgctgccggtctgcccggaaagcgtccgttccacggcggcg
gcccggggcgtgatgccggacccagagatcgcgtcgattcattaccggtccgacgaggtc
cggcccggtggcctgtttgtggccattcggggcagtgccagagacggccatgattttatc
gaccaggccctggccaggggcgccgtggccgtggtggcggaaaaagaggtggatgcccgc
gacgccgtgacggtgcgggtggctgacgcccggaacgccctggcgttgctgtccgctgtt
ttctacggcgcgccctcggcaaggcttgtactggtcggtgtcaccggcaccaacggcaag
accaccaccgcggctctggtggagcacatactggtaaaggcgggaaaacaggtgggggtg
atcggtaccggcaattttcgttacgtgggccggcggttcaaaaacccgctgaccacgccg
gagtcggccgacctgcaacacattctgcgtgacatggcaacagccggcgttacccatgtg
gtcatggaggtctcctcccacgccctggcccagcagcgggtggccgggtgcgcctttgac
gtggccatcttcaccaacctgacccaggatcacctggattttcacggggacatggagacc
tactgggagtgcaaaaaacgactgtttaccggaacccggtccgtgggcgtccgggaaaag
cacatggtctcggtgatcaactgtaatgatgcccggggacggggcctgtttgatacgctg
cccgtgcccggtcgcatgggcgcggggttcgccgaggcatgtgacatttatccaaagggg
gtgaccagctctccggacggccttgccggcacaattgtgacgccggccggaccgatccca
ttctgctcaccgctggccggcacctataaccttgaaaacattctctgcgcggccggcgcc
ggtgttgtcctgggcgtggaaggggcggcgattcaggaaggcatcgagacctttgccggt
gtgcccggccgcctggaaaaggtggccgaccggatgggccgctttgtttttgtggattat
gcccatacaccggatgcccttcaaaacgtgctgtcggcccttcgaaagatatctgccggc
cggcttttctgcgtgttcggctgcggcggcgaccgggacagggccaagcggccgaaaatg
ggcgggattgccgccactattgccgaccgggtggtggtgacgtcggacaatccgagaagt
gaggatccggaagccattatcgcggatattgtaaagggaatgaccggcctggccgagcgg
gtggccgatgtggccggcctggccggaaaaagcagtaatggccggtacctggtggagccg
gaccgccgtctggccatacgggccgctgtgtcggccgcggctcccggcgacaccattctg
atcgccggcaagggagaggagaactaccagatattcagggacaggaccattgattttgat
gacaggcaggaggccgcggccgcgctgcaggcccgggggaattccgggaacgaccagatg
cccgccatgtcggcggggcagtgcggatag

DBGET integrated database retrieval system