KEGG   Candidatus Desulfococcus oleovorans: Dole_2816Help
Entry
Dole_2816         CDS       T00610                                 

Definition
4-diphosphocytidyl-2C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
dol  Candidatus Desulfococcus oleovorans
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:dol00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3398264..3399121
Genome map
AA seq 285 aa AA seqDB search
MKVLSPAKINLFLHVTGKRADGYHDLFTLMCCIGLFDELTFELTDSGVSVRCDHSAVPSD
ASNLAHRAATLFFERTGIQAGVSITLVKHIPVAAGLGGGSSNAATVLVWLNNRFGRPLSM
DRLLEMGALLGADVPFFIFGRPALATGIGNRLVAYPLLPSLPVVLIHPDIPVSTGDIYKS
FNLTLTNNKKISTIHSFTKQTPFEFAKHLENDLETVTLERYPEIGAAKKRLVAAGARGVL
MSGSGPAVFGVFKDPAAAEQAYATIPRQTGERLFCATLLTAGHTA
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtgctgtcccctgccaaaatcaacctgtttttgcacgtcaccggaaagcgggcc
gacgggtatcacgatctttttaccctgatgtgctgcatcggcctgtttgacgagctgaca
ttcgaactcaccgacagcggcgtttcggtccggtgtgaccattcagcggttccctccgat
gcttccaacctggcccaccgggccgcgaccctcttttttgagcgtaccggcattcaggcc
ggggtctccatcacccttgtcaagcacattcctgtggccgccggcctgggcggcggcagc
agcaacgccgcaacggtcctggtgtggctcaacaaccggttcgggcggccgctctccatg
gaccgccttctggagatgggggcccttctgggcgcggatgtgccgtttttcatctttggc
cggccggcccttgccaccggcatcggaaaccgccttgtcgcctaccctctcctgccctcc
ctgccggtggtgctgatccatccggacattcctgtttccaccggcgatatctacaaaagt
ttcaatttaacattgacaaataacaaaaaaatttctacgatccattcttttacaaaacag
acgccttttgagtttgcaaaacaccttgaaaacgatctggaaacggttactctggagcga
tatccggagataggggccgccaaaaaaagactggtggccgccggcgcgcggggtgttctg
atgtccggcagcggccctgccgtgttcggcgtttttaaggacccggcggcggcggaacag
gcctatgcgacgattccccggcagacgggagaacggctgttttgcgcgacattactgacg
gcgggacatacggcttga

DBGET integrated database retrieval system