KEGG   Candidatus Desulfococcus oleovorans: Dole_3062Help
Entry
Dole_3062         CDS       T00610                                 

Definition
uroporphyrin-III C-methyltransferase
Orthology
K13542  
uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
dol  Candidatus Desulfococcus oleovorans
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dol00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Dole_3062
Enzymes [BR:dol01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     Dole_3062
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Dole_3062
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3669403..3670941
Genome map
AA seq 512 aa AA seqDB search
MAHSMKGKVYLVGAGPGDPALITLRGLECIRMADVVVYDYLAADQLLHHRSENAEVIYVG
KKGGDHTLSQNKINDLIVEKAEQGLVVTRLKGGDPFIFGRGGEEAEILAARNIPFEIVPG
VTSAIAAPAYAGIPLTHREHTTSVSFITGHEDPTKEQSTIHWQALAETGGTLVFLMGVKN
LSFIVDRLMEHGRPGTTPAALVRWGTTPMQQTVTGTLDTIVDRVKAAGLQAPCIIVIGGV
VNLRETIAWFEASRPLLGKTIVVTRARAQASDFIAALSRLGAACIECPTIRVAPPDDTAP
LDTAIDNLAAYDWLVFTSVNGVDRFFARLFEKGGDVRRLGHLKTAVIGPATEQRLLDFGV
KSDIVPESFRAESVVEAFTRQDVKGKSVLLPRAAEARPILPEELTKMGARVDEVAAYVTR
QDDSAAKTLTEALESGAVDMVTFTSSSTVKNFKALLPKDKSTADRLIKNVAVASIGPITT
ETAKDEGFAVHVTADAYTIEGLTRAIIDYFKA
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atggcgcatagcatgaaaggaaaagtttacctggtgggggcgggccccggtgatccggca
ctgataacccttcgcggactcgagtgcattcgcatggccgatgtggtggtctacgactac
ctggccgccgaccagctcctgcaccaccggtcggaaaacgccgaagtcatctacgtggga
aaaaaaggcggggaccataccctttcccagaacaagatcaacgatctgatagtggagaag
gcggaacaggggctggtggtgacccggctcaagggcggggacccctttatattcggtcgc
ggcggtgaagaggcggaaatcctggccgcccgcaacattccctttgaaatcgtgcccggc
gtgacctcggccatcgcggccccggcctatgccggtattcccctgacccaccgggagcat
accacgtcggtttcctttatcaccggccatgaagatcccaccaaggaacagtccaccatt
cactggcaggccctggccgagaccggcggcaccctggtgttcctgatgggggtaaagaac
ctctcttttatcgtggaccggttgatggaacacggccggccgggaaccacacccgcggcc
ctggtacgatggggcaccacgcccatgcagcagaccgtgaccggcacccttgacaccatc
gtggacagggtaaaggccgccgggcttcaggccccgtgcatcattgtcatcggcggggtg
gtgaacctgagagagaccattgcctggtttgaagcctcccggccccttctgggaaagacc
attgtggtgacccgagcccgggcccaggccagtgattttatcgcggcgctttcgcgcctg
ggcgcggcctgtattgagtgtcccaccattcgagtggccccgcccgacgataccgcacct
ctggacacggccatcgacaacctggccgcctatgactggctggtctttaccagcgtcaac
ggggtggaccgtttctttgcccggctgtttgaaaaaggtggagatgtgcgacgcctgggg
catcttaaaaccgcggtcatcggaccggccacggaacagcggcttctggatttcggcgta
aaaagcgatatcgtgccggaaagctttcgggccgaatcggtggtggaggcatttacccgg
caggacgtgaaaggcaaaagcgtactgctgcccagggccgccgaggcccggcccattctt
cccgaagaactgacgaagatgggggcacgggtggacgaggtggcagcctatgtgacacgg
caggacgattccgcggccaaaacccttacagaagctctggagagcggggccgtcgacatg
gtcacctttaccagctcctctacggttaaaaacttcaaggccctgctgccaaaggacaag
tccacggcagaccggctgataaagaatgtggcggtggcttccatcggccccatcaccacg
gaaaccgcgaaagacgagggctttgcggttcatgtcaccgcggacgcttatacgatagaa
ggcctgacccgggccatcatcgactattttaaggcataa

DBGET integrated database retrieval system