KEGG   Desulfosporosinus orientis: Desor_0007Help
Entry
Desor_0007        CDS       T01675                                 

Definition
DNA gyrase subunit A
Orthology
K02469  
DNA gyrase subunit A [EC:5.99.1.3]
Organism
dor  Desulfosporosinus orientis
Brite
Enzymes [BR:dor01000]
 5. Isomerases
  5.99  Other isomerases
   5.99.1  Sole sub-subclass for isomerases that do not belong in the other subclasses
    5.99.1.3  DNA topoisomerase (ATP-hydrolysing)
     Desor_0007
DNA repair and recombination proteins [BR:dor03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHIIR (short-homology-independent illegitimate recombination)
     Facilitator
      Desor_0007
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6795..9269
Genome map
AA seq 824 aa AA seqDB search
MADEIIGGKVLPVEIADEMRRSFIDYSMSVIVSRALPDVRDGLKPVHRRILYTLHELGLT
PNKPYSKSARLVGDCMGKFHPHGDSSIYDAVVRLEQDFASRYPLVDGHGNFGSIDGDSAA
AMRYTELRMEKITTYMLEDIDKDTIDFTPNYDEKQEEPTVLPSKFPNLLVNGSSGIAVGM
ATNIPPHNLTEVIDATVALLDDPNLSVDNLMDYIKGPDFPTGATIMGHEGIRSAYLTGRG
SIKLRAKAEIEQMEKSGKTRIIVTEIPFLVNKARMIEKIADLVREKKIDGITDLRDESDR
SGMRIVIELRRDVNPKVILNQLYKHTQLEDTFGVNMLALVDGQPRTLNLKDMIHYFIEHQ
KDVIVRRTRFELNKAEAEAHIIEGLRIALDHIDEVIETIRSSPDESKARENLTIRFGLSE
KQAQAIVDMRLKRLTGLEREKLENQYQDLMNTIAYLKAVLASEAMVIGIIKNKLEEIKSK
FGDSRRTLITIDVSKMDVEDLIAVEDVVVTVTHYGYIKRLPLSTYKSQNRGGKGVHGMAT
KEEDFVEHLFTTTTHHYILFFTSQGKVYRLKAHEIPESSRTAKGTAVINLLNLGQDEMIT
AVMAIKEYSPDYFLITATKNGIMKKTALQEYDSARKDGLIALTLDEGDELIGVKLTQGLD
DILLATKKGIAIRFPESEVRYMGRTARGVKGIKLEENDMVVGMDVIGDEGELLTMSENGF
AKRTDLKEFRVQGRGGRGVIGMKLNAKTGNLVGIKVVHVEDELMVITNNGIMLRIPVSSI
SNQGRSAQGVLAMRTGDSNVVAIAKVVMKDDEDTGENADSEAED
NT seq 2475 nt NT seq  +upstreamnt  +downstreamnt
atggcggatgaaattataggggggaaagttcttcccgttgaaatcgcggatgaaatgcga
agatcatttatcgactattcgatgagtgttatcgttagtcgtgctttgcctgacgttcga
gatgggctaaaaccggttcatcgcagaatattgtatacccttcatgagttgggtttaact
cctaacaagccttatagtaaatcggcacgtcttgttggagattgcatgggtaaatttcat
ccccatggagattcctcaatttatgatgcggtggttcgtttagaacaagattttgctagt
cgatatccccttgttgatgggcatggcaattttggttctatcgatggggactctgctgca
gcaatgcgttatactgagctgcgcatggaaaaaataacaacgtatatgttagaggatatc
gataaagataccattgatttcacaccaaattatgatgaaaaacaagaagaacctactgta
ttgccatctaaatttccgaatctgctggtaaacggttcttcaggaattgccgtcggaatg
gcaaccaatattccaccccataatttgacagaagttattgatgcgacggttgccttattg
gatgaccctaacttatcagttgataatctaatggactatatcaaaggtccggattttcct
actggtgctacaattatgggtcatgaaggtataaggtctgcttatctgactgggagaggc
tcaattaaattaagggctaaagccgaaattgagcaaatggaaaaatcaggaaaaactcgt
attattgttacggaaattccttttttagttaataaagctcgtatgattgagaagatcgct
gatcttgttcgtgaaaagaaaatagatggaattacagatctaagggacgaatctgatcgt
tcaggaatgcggattgttattgaattaaggcgtgatgtcaatcctaaagtgatattgaat
cagctctataagcatactcagctggaggacacctttggtgtaaatatgttggcattagtg
gatggacagccaagaactttgaatcttaaggatatgattcattactttattgaacaccaa
aaagatgttattgttcgaagaactcgatttgaacttaataaagctgaagctgaagctcac
attattgaaggattgaggattgcccttgatcatattgatgaagttattgaaacaattcgc
tcttccccagatgaatcaaaggcaagagagaatttaactatacgctttggtttaagtgaa
aaacaagctcaggccattgttgacatgagattaaaacggttaactgggttagaacgagag
aaattagaaaatcaatatcaagatttaatgaataccatcgcctatctcaaggctgtactt
gcctcagaggctatggtcataggtataataaagaataaacttgaagaaataaagagcaag
tttggagattcacgacgaacgcttataactattgatgtaagtaaaatggacgtcgaggat
ttaattgctgtcgaagatgttgtggtaacagtaactcactacggttatattaaacggtta
ccgttaagtacttataagagtcaaaatcgtggaggcaaaggtgttcatgggatggctact
aaagaagaagattttgtagaacatctcttcaccacgacgacacatcattatattcttttc
tttacatcacaagggaaagtttatcgattgaaagctcatgaaattccagaatcaagtcgt
actgctaaaggtactgctgttataaatctattgaatttaggtcaggatgaaatgattacc
gcagtaatggctatcaaggagtatagtccggattattttctgataacagcaacaaagaat
ggtatcatgaaaaaaacggcattgcaggaatatgactcggccaggaaagatgggttaatt
gctttgactttggatgaaggagatgaacttattggcgttaaattaacccaaggtttggat
gatattcttttagcaaccaaaaaaggaatagctattcgtttcccagaatctgaagttcgt
tatatgggacgcactgcccgtggagttaaaggcataaagttagaagaaaatgatatggtt
gtcggtatggatgttataggcgatgaaggcgagcttctaaccatgagtgaaaatgggttt
gccaaacgtactgatctaaaagaattccgtgttcaaggacgtggcggcagaggggttatc
ggcatgaaattgaatgcaaaaaccggcaatttggttggcattaaagttgttcatgtcgaa
gatgagctgatggtgatcactaataatgggattatgctaagaattcctgtatcaagtatc
tcaaaccaaggacgttctgcacagggtgttttagctatgcgtacaggtgacagcaatgtt
gttgccatcgctaaagttgtcatgaaagatgatgaagatactggggaaaacgctgattca
gaggctgaagactaa

DBGET integrated database retrieval system