KEGG   Desulfosporosinus orientis: Desor_0022Help
Entry
Desor_0022        CDS       T01675                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
dor  Desulfosporosinus orientis
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:dor00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Desor_0022
DNA repair and recombination proteins [BR:dor03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Desor_0022
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
18824..19420
Genome map
AA seq 198 aa AA seqDB search
MDFLKYPQPLADLISNLARLPGIGPKTAGRLAFYLLQQPQVSEELAKAMLVANRDIRKCS
ICSNFTDQDPCAICCNTQRDQTSLCVVEHPRDVVSLEKTREFHGVYHVLHGVLSPMDGIG
PEQLTISQLLKRLEGVKEVVMAMNPTVEGEATALYLARLLKPMGIKVSRIAHGLPVGGDL
EYADEITIARALEGRRDL
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atggactttttaaaatacccacaacctctggcagatctcataagcaacttagcacgcttg
cctgggattggacctaaaacagcaggacggttagcattttatcttcttcaacagccccaa
gtttctgaggagttggcaaaggctatgcttgttgccaatagagatattcggaagtgttca
atttgttcaaactttaccgatcaagacccctgtgcaatttgctgtaatacgcaaagagat
caaacatctctttgcgttgttgagcatcccagagatgtcgtgtctttggagaaaacaagg
gaattccatggagtatatcatgtactccatggtgtactctcaccaatggacggaattggt
cctgaacagctaacgataagtcagcttctaaaacgattagagggtgtaaaagaagtcgta
atggcaatgaatcccacagttgagggagaagccacagctttatatttagcacgtctgctt
aaaccgatgggaatcaaggtttcacgaatagcacatgggctgcctgttggcggtgattta
gaatatgctgatgaaataaccattgcacgggctttagaaggcagaagggacttataa

DBGET integrated database retrieval system