KEGG   Desulfosporosinus orientis: Desor_0053Help
Entry
Desor_0053        CDS       T01675                                 

Definition
(GenBank) 4-diphosphocytidyl-2C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
dor  Desulfosporosinus orientis
Pathway
dor00900  Terpenoid backbone biosynthesis
dor01100  Metabolic pathways
dor01110  Biosynthesis of secondary metabolites
dor01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:dor00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Desor_0053
Enzymes [BR:dor01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Desor_0053
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_C GHMP_kinases_N DUF296 ACT
Motif
Other DBs
NCBI-ProteinID: AET65811
UniProt: G7W7E0
Position
52321..53205
Genome map
AA seq 294 aa AA seqDB search
MEQSFLTTFANAKINLALAIQGIQEDGYHELQSVMQSIELHDIVRVRRHGEKVVCRCGAL
SGPGNLAYKAAIEFLSQSGKSGGLEIEIKKQIPIQAGLAGGSTDAAATLRLLNQLYGNPF
NNEELLKLAAQCGADVAFCLQGGTMWATGRGEQLELLPAAPRVDLVIMKPYAGVNTREAY
RRFDLVGHSGQLTRKDWEEALAGGSIKQIAGLLYNDLEAASIPLVPQIDKFKQSLLESGC
YGSLMSGSGSSVFGIAQGEQHARQVAEQLRKKGFRNVWVTKTIGAVTNCMKGDS
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atggaacagtctttccttacaacgttcgcaaacgctaagataaatttggctttagccatt
caaggaattcaagaagatggttatcatgaacttcaaagtgttatgcaatctattgagttg
catgacattgttcgagttcgacgtcatggggaaaaagtagtgtgtcgctgtggagcatta
agcggacctggaaacctagcttataaagcagctatagaatttttgagccaaagtggaaaa
tctggaggacttgaaattgaaattaaaaagcagattcccattcaagcaggactagctgga
ggaagtactgatgcagctgcaaccctgcggttattaaatcaactctatggaaatcctttc
aataatgaggagttgcttaaactggcagctcaatgtggcgcagatgtagctttttgtctt
caaggcgggacaatgtgggctacaggaagaggtgagcagcttgaattattaccggcggcg
cctagggtagatcttgttataatgaaaccttatgctggcgtaaacacaagggaagcgtat
cggcggtttgatttagttggacattcagggcagctaacaagaaaggattgggaagaggct
ttagcgggagggtcaattaaacagattgctggcctgctctataacgatcttgaggcagct
tcaatcccgttggtgccgcaaattgataaattcaagcaaagcctgctagagtcaggatgt
tatggatccttaatgtccggcagtggttcaagtgtctttggaattgcccaaggagagcaa
catgcaaggcaggttgctgaacagttgagaaaaaaaggctttagaaatgtttgggtaaca
aaaacgataggtgcagtaactaattgtatgaaaggggatagttag

DBGET integrated database retrieval system