KEGG   Desulfosporosinus orientis: Desor_0053Help
Entry
Desor_0053        CDS       T01675                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
dor  Desulfosporosinus orientis
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:dor00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
52321..53205
Genome map
AA seq 294 aa AA seqDB search
MEQSFLTTFANAKINLALAIQGIQEDGYHELQSVMQSIELHDIVRVRRHGEKVVCRCGAL
SGPGNLAYKAAIEFLSQSGKSGGLEIEIKKQIPIQAGLAGGSTDAAATLRLLNQLYGNPF
NNEELLKLAAQCGADVAFCLQGGTMWATGRGEQLELLPAAPRVDLVIMKPYAGVNTREAY
RRFDLVGHSGQLTRKDWEEALAGGSIKQIAGLLYNDLEAASIPLVPQIDKFKQSLLESGC
YGSLMSGSGSSVFGIAQGEQHARQVAEQLRKKGFRNVWVTKTIGAVTNCMKGDS
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atggaacagtctttccttacaacgttcgcaaacgctaagataaatttggctttagccatt
caaggaattcaagaagatggttatcatgaacttcaaagtgttatgcaatctattgagttg
catgacattgttcgagttcgacgtcatggggaaaaagtagtgtgtcgctgtggagcatta
agcggacctggaaacctagcttataaagcagctatagaatttttgagccaaagtggaaaa
tctggaggacttgaaattgaaattaaaaagcagattcccattcaagcaggactagctgga
ggaagtactgatgcagctgcaaccctgcggttattaaatcaactctatggaaatcctttc
aataatgaggagttgcttaaactggcagctcaatgtggcgcagatgtagctttttgtctt
caaggcgggacaatgtgggctacaggaagaggtgagcagcttgaattattaccggcggcg
cctagggtagatcttgttataatgaaaccttatgctggcgtaaacacaagggaagcgtat
cggcggtttgatttagttggacattcagggcagctaacaagaaaggattgggaagaggct
ttagcgggagggtcaattaaacagattgctggcctgctctataacgatcttgaggcagct
tcaatcccgttggtgccgcaaattgataaattcaagcaaagcctgctagagtcaggatgt
tatggatccttaatgtccggcagtggttcaagtgtctttggaattgcccaaggagagcaa
catgcaaggcaggttgctgaacagttgagaaaaaaaggctttagaaatgtttgggtaaca
aaaacgataggtgcagtaactaattgtatgaaaggggatagttag

DBGET integrated database retrieval system