KEGG   Desulfosporosinus orientis: Desor_0083Help
Entry
Desor_0083        CDS       T01675                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
dor  Desulfosporosinus orientis
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dor00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Desor_0083
Enzymes [BR:dor01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     Desor_0083
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
81676..82146
Genome map
AA seq 156 aa AA seqDB search
MRVKVFIGLGTNLGDRGFYLSEAVSSLNRPAIKVEAMSRTYESEPWGVADQPLFWNQVIQ
VETTLEPLDLLHACQEIEQQLGRERKVHWGPRTIDIDLLIYDNRVSDSEELKLPHPYLEE
RAFVIVPLREIAPDLILPSGRPICEVQGEGKVYPLT
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
gtgagagtgaaggtattcatcggattaggcaccaatctgggggatcgtggcttttatctt
agtgaggctgtctcttctctaaaccgtccagccattaaggttgaagcaatgtctcgaact
tatgaatcagaaccttggggagttgctgatcagccattattttggaatcaagtcatacaa
gttgagacaaccctggaaccgctggatcttcttcatgcttgtcaagaaattgagcagcag
ttgggaagagagcgcaaagtgcattgggggccaaggacgattgacatagacttacttatt
tatgataatagagttagtgattctgaggaactgaaattacctcatccctacttggaagaa
cgagcttttgtgattgtacctttacgagagattgctcccgacctcatcctgccttcagga
agacccatttgtgaagttcagggtgaaggaaaagtttatcctcttacttaa

DBGET integrated database retrieval system