KEGG   Desulfosporosinus orientis: Desor_0191Help
Entry
Desor_0191        CDS       T01675                                 

Definition
succinyl-CoA synthetase subunit beta
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
dor  Desulfosporosinus orientis
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:dor00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Desor_0191
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Desor_0191
   00640 Propanoate metabolism
    Desor_0191
   00660 C5-Branched dibasic acid metabolism
    Desor_0191
Enzymes [BR:dor01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Desor_0191
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
187334..188611
Genome map
AA seq 425 aa AA seqDB search
MAKFLEFQGKEWLRKSGLPVPQGRVASTPEEAKQIAEEIGKAVAVKGQVQAGGRGKAGIV
KLVNTPDEAAAAAAEILAKTIGKNPIKQVLVEEKLDIKKEYYCSFVINGAREARSPMLMF
SAEGGMDIESVPEELIFKVNVDPINGLQIYDAVDVCARAGIPPQDLNKFAGFLSKLSQAY
KKLDCQTLEINPFVMTGSGNLVCADCKMEIDNSSVGRHPEFGISIARDLPGAPTELDLIG
WSIEETDARGTGFLMNMGYDEVSPGYIGYHPIGGGSAMMGLDALNQVGLKPANYADTSGN
PVGSKIYRVAKCVLSQPNIDGYLLGGFMMANQEQWHHAHAIVKVLREILPTQKPGLPCVL
LLCGNREDESLEILRTGLADLMTPDGPGKRIEIYGKEYVTDTKFIGQRLLALSKEYRAEK
ESQGK
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaatttctagaattccagggaaaagagtggcttagaaaatcaggactgccggta
cctcaaggccgggtagcctccactccggaagaagctaagcagattgccgaggaaataggc
aaagccgttgccgtaaaaggccaggttcaggcaggcggacgtggtaaagcaggaatcgtt
aaattagtcaatactccagatgaagcagcagccgctgcagctgaaattcttgctaaaact
attggaaaaaatcctatcaaacaagttctcgttgaagaaaagctggacattaaaaaagag
tattactgttcctttgttattaacggagccagggaagcacgttctcctatgctgatgttc
agtgctgaaggcggaatggatattgaaagtgttccggaagagctgattttcaaagttaac
gttgatcctatcaatggccttcaaatttatgacgcagtggatgtttgcgctcgtgccggc
attcctcctcaagatctgaataagtttgcaggttttctctcgaagctgtcccaagcttac
aaaaaactggactgccaaactcttgaaatcaatccttttgttatgacgggtagcggaaac
ttggtatgtgcagactgcaaaatggaaattgacaacagttccgttggacgtcatccggag
tttggaatttccatcgccagggatctgccgggtgctcccacagagctagacttaatcggc
tggagcatcgaagaaacagatgcccgcggaacagggttcctgatgaatatgggctatgac
gaagtaagccctggctatatcggctaccatccaatcggcggcggatcagccatgatgggc
ttggatgccttgaaccaagttggccttaaaccggctaactatgcagataccagcggtaac
cctgttggctcaaaaatttaccgggttgctaaatgcgtactgtctcagcccaatattgac
ggctacctcttgggcggattcatgatggccaatcaagagcagtggcatcatgctcacgct
atcgtcaaagtactcagagagattctgcccacccaaaagccgggactgccttgtgtactg
ctcctctgcggcaaccgggaagatgaatctttggaaattctcagaacaggtctggctgac
ttaatgactcccgatggtcctggtaagagaattgaaatttacggtaaagagtatgtaaca
gatacgaaattcatcggacaacgacttctggctctgagcaaagaatatagagctgaaaaa
gaatctcaaggaaagtag

DBGET integrated database retrieval system